KEGG   Mus musculus (mouse): 15562Help
Entry
15562             CDS       T01002                                 

Gene name
Htr4, 5-HT-4, 5-HT4, 5-HT<4L>, 5HTR4
Definition
(RefSeq) 5 hydroxytryptamine (serotonin) receptor 4
  KO
K04160  
5-hydroxytryptamine receptor 4
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    15562 (Htr4)
   04024 cAMP signaling pathway
    15562 (Htr4)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15562 (Htr4)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    15562 (Htr4)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    15562 (Htr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
18; 18 D3
AA seq 388 aa AA seqDB search
MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSN
STWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRP
QPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVDPFIDYTVPEQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPILGQTVPCSTTTINGSTHVLRD
TVECGGQWESRCHLTATSPLVAAQPSDT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacttgatgctaatgtgagttccaacgagggtttcaggtccgtggagaaggtc
gtgctgctcacgttccttgcagtggttatcctgatggccatcttgggcaacctgctggtg
atggtggctgtgtgcagggacaggcagctcaggaaaataaaaaccaactatttcattgtg
tctctcgcctttgctgacctgctggtttcggtgctggtgatgccctttggtgccattgag
ctggtccaagacatctgggcttatggggagatgttctgcctggtccggacctctctggat
gtcctacttaccacagcatcgatctttcacctgtgctgtatttccctggacaggtattac
gccatctgctgccagcctttggtttataggaacaagatgacccctctacgcatcgcatta
atgttgggaggctgctgggtccttcccatgtttatatcttttctccccataatgcaaggc
tggaacaacatcggcatagttgatgtgatagagaaaaggaaattcagccacaactctaac
tccacgtggtgtgtcttcatggtcaacaagccctatgctatcacctgctctgtggtggcc
ttctacatcccgtttctcctcatggtgctggcctattaccgaatctatgtcactgctaag
gagcatgcccagcagatacagatgttacaacgggcaggagccacctctgaaagcaggccc
cagccagctgaccagcacagcacacatcgcatgaggacagagaccaaggcagccaagact
ttatgtgtcatcatgggctgcttctgtttctgctgggcccccttctttgtcaccaatatt
gtggaccctttcatagactacactgtccccgagcaggtgtggactgctttcctctggctt
ggctatatcaattcggggttgaacccttttctctatgccttcttgaataagtctttcaga
cgtgccttcctcatcatcctctgctgtgatgatgagcgctacaaaagaccccccattctg
ggccagactgtcccctgttcaaccacaaccattaatggatccacccatgtactaagggat
acagtggaatgtggtggccagtgggagagtcggtgtcacctcacagcaacttctcctttg
gtggctgctcagcccagtgatacttaa

DBGET integrated database retrieval system