KEGG   Mus musculus (mouse): 15566Help
Entry
15566             CDS       T01002                                 

Gene name
Htr7, 5-HT7
Definition
(RefSeq) 5-hydroxytryptamine (serotonin) receptor 7
  KO
K04163  
5-hydroxytryptamine receptor 7
Organism
mmu  Mus musculus (mouse)
Pathway
Ras signaling pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    15566 (Htr7)
   04020 Calcium signaling pathway
    15566 (Htr7)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15566 (Htr7)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    15566 (Htr7)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    15566 (Htr7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19 C2; 19 30.3 cM
AA seq 448 aa AA seqDB search
MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWMPHLLSGFPEVTASPA
PTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSN
YLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVIS
IDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDF
GYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFSGFPRVQPESVISLNGVVKLQK
EVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTS
CSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE
ALKLAERPERSEFVLQNCDHCGKKGHDT
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgttaacagcagcggccgccccgacctctacggccatctccgctctctcatc
ctgccggaggtggggcgcaggctgcaggacctgagccccgacggtggcgcccactcggtg
gtgagctcctggatgccgcacctgctgagcggcttcccagaggtgacagctagcccggcg
cccacctgggacgcgcccccggacaatgtctccggctgcggggagcagatcaactatggc
agagtcgagaaagttgtgatcggctccatcctgacgctcatcacgctgctgacgatcgcg
ggcaactgcctggtggtgatctcggtgtgctttgtcaagaagctccgccagccctccaac
tacctgattgtgtccctggcgctggctgacctctcggtggccgtggcggtcatgcctttc
gttagtgtcacggacctcatcgggggcaagtggatcttcggccacttcttctgcaacgtc
ttcatcgccatggacgtcatgtgctgcacggcctcgatcatgaccctgtgcgtgatcagc
atcgacaggtaccttgggatcaccaggcccctcacgtaccccgtgaggcagaatgggaaa
tgtatggccaaaatgattctgtcggtctggcttctctctgcctccatcaccttacctcct
ctcttcggatgggctcagaatgtgaacgatgacaaagtgtgcttgatcagccaggatttt
ggctacacgatctactccaccgcagtggcgttttatatccccatgtcggtcatgctgttc
atgtactatcagatttacaaggccgccaggaagagcgcagccaaacacaagttctcaggc
ttcccacgcgtgcagccggagagcgtcatctccctgaatggcgtggtgaaactccagaag
gaggtggaagagtgtgcgaacctttcgagactgctcaaacacgaaaggaaaaacatttcc
atcttcaagagggaacagaaagcagccactaccttggggatcatcgtgggagccttcacg
gtgtgctggctgccgtttttcctcttgtccacagcaaggccctttatctgtggcacctcc
tgtagctgcatcccgctgtgggtggagaggacatgtctgtggctgggctatgcaaactct
ctcattaacccttttatatatgccttcttcaaccgggacctgaggaccacctatcgtagc
ctactccagtgccagtaccggaatatcaaccggaagctctctgctgcaggcatgcacgaa
gccctgaaacttgctgagaggcctgagagaagcgagtttgtgctacaaaactgtgaccac
tgtgggaaaaaaggtcatgatacatga

DBGET integrated database retrieval system