KEGG   Mus musculus (mouse): 15874Help
Entry
15874             CDS       T01002                                 

Gene name
Iapp, DAP
Definition
(RefSeq) islet amyloid polypeptide
  KO
K08039  
islet amyloid polypeptide
Organism
mmu  Mus musculus (mouse)
Pathway
Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    15874 (Iapp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 G2; 6 73.81 cM
AA seq 93 aa AA seqDB search
MMCISKLPAVLLILSVALNHLRATPVRSGSNPQMDKRKCNTATCATQRLANFLVRSSNNL
GPVLPPTNVGSNTYGKRNAAGDPNRESLDFLLV
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgcatctccaaactgccagctgtcctcctcatcctctctgtggcactgaaccac
ttgagagctacacctgtcagaagtggtagcaaccctcagatggacaaacggaagtgcaac
acggccacgtgtgccacacaacgcctggcaaactttttggttcgttccagcaacaacctt
ggtccagtcctcccaccaaccaacgtgggatcgaatacatatggcaagaggaatgcggca
ggggatccaaatagggaatccttggatttcttactcgtttaa

DBGET integrated database retrieval system