KEGG   Mus musculus (mouse): 15926Help
Entry
15926             CDS       T01002                                 

Gene name
Idh1, AI314845, AI788952, E030024J03Rik, Id-1, Idh-1, Idpc
Definition
(RefSeq) isocitrate dehydrogenase 1 (NADP+), soluble
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00480  Glutathione metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01210  2-Oxocarboxylic acid metabolism
mmu01230  Biosynthesis of amino acids
mmu04146  Peroxisome
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    15926 (Idh1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    15926 (Idh1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    15926 (Idh1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     15926 (Idh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 15926
NCBI-ProteinID: NP_001104790
MGI: 96413
Ensembl: ENSMUSG00000025950
Vega: OTTMUSG00000021898
UniProt: O88844
Structure
PDB: 

Jmol
Position
1 C2; 1 32.91 cM
AA seq 414 aa AA seqDB search
MSRKIQGGSVVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VTGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPKDGTQKVTYMVHDFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKKYKSQFE
AQKICYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWSRGLAHRAKLDNNTELSFFAKALE
DVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKAKLAQAKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaaaatccaaggaggttctgtggtggagatgcaaggagatgaaatgacacga
atcatttgggaattgattaaggaaaaacttattcttccctatgtggaactggatctgcat
agctatgatttaggcatagagaatcgtgatgccaccaatgaccaggtcaccaaagatgct
gcagaggctataaagaaatacaacgtgggcgtcaagtgtgctaccatcacccccgatgag
aagagggttgaagaattcaagttgaaacaaatgtggaaatccccaaatggcaccatccga
aacattctgggtggcactgtcttcagggaagctattatctgcaaaaatatcccccggcta
gtgacaggctgggtaaaacccatcatcattggccgacatgcatatggggaccaatacaga
gcaactgattttgttgttcctgggcctggaaaagtagagataacctacacaccaaaagat
ggaactcagaaggtgacatacatggtacatgactttgaagaaggtggtggtgttgccatg
ggcatgtacaaccaggataagtcaattgaagactttgcacacagttccttccaaatggct
ctgtccaagggctggcctttgtatctcagcaccaagaacactattctgaagaagtatgat
gggcgtttcaaagacatcttccaggagatctatgacaagaaatacaagtcccagtttgaa
gctcagaagatctgctatgaacacaggctcatagatgacatggtggcccaagctatgaag
tccgagggaggcttcatctgggcctgtaagaattacgatggggatgtgcagtcagactca
gtcgcccaaggttatggctcccttggcatgatgaccagtgtgctgatttgtccagatggt
aagacggtagaagcagaggctgcccatggcactgtcacacgtcactaccgcatgtaccag
aaagggcaagagacgtccaccaaccccattgcttccatttttgcctggtcccgagggtta
gcccacagagcaaagcttgataacaatactgagctcagcttcttcgcaaaggctttggaa
gacgtctgcattgagaccattgaggctggctttatgactaaggacttggctgcttgcatt
aaaggcttacccaatgtacaacgttctgactacttgaatacatttgagtttatggacaaa
cttggagaaaacttgaaggccaaattagctcaggccaaactttaa

DBGET integrated database retrieval system