KEGG   Mus musculus (mouse): 15926Help
Entry
15926             CDS       T01002                                 

Gene name
Idh1, AI314845, AI788952, E030024J03Rik, Id-1, Idh-1, Idpc
Definition
(RefSeq) isocitrate dehydrogenase 1 (NADP+), soluble (EC:1.1.1.42)
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mmu  Mus musculus (mouse)
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Peroxisome
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    15926 (Idh1)
   01210 2-Oxocarboxylic acid metabolism
    15926 (Idh1)
   01230 Biosynthesis of amino acids
    15926 (Idh1)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    15926 (Idh1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    15926 (Idh1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    15926 (Idh1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     15926 (Idh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1 C2; 1 32.91 cM
AA seq 414 aa AA seqDB search
MSRKIQGGSVVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VTGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPKDGTQKVTYMVHDFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKKYKSQFE
AQKICYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWSRGLAHRAKLDNNTELSFFAKALE
DVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKAKLAQAKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaaaatccaaggaggttctgtggtggagatgcaaggagatgaaatgacacga
atcatttgggaattgattaaggaaaaacttattcttccctatgtggaactggatctgcat
agctatgatttaggcatagagaatcgtgatgccaccaatgaccaggtcaccaaagatgct
gcagaggctataaagaaatacaacgtgggcgtcaagtgtgctaccatcacccccgatgag
aagagggttgaagaattcaagttgaaacaaatgtggaaatccccaaatggcaccatccga
aacattctgggtggcactgtcttcagggaagctattatctgcaaaaatatcccccggcta
gtgacaggctgggtaaaacccatcatcattggccgacatgcatatggggaccaatacaga
gcaactgattttgttgttcctgggcctggaaaagtagagataacctacacaccaaaagat
ggaactcagaaggtgacatacatggtacatgactttgaagaaggtggtggtgttgccatg
ggcatgtacaaccaggataagtcaattgaagactttgcacacagttccttccaaatggct
ctgtccaagggctggcctttgtatctcagcaccaagaacactattctgaagaagtatgat
gggcgtttcaaagacatcttccaggagatctatgacaagaaatacaagtcccagtttgaa
gctcagaagatctgctatgaacacaggctcatagatgacatggtggcccaagctatgaag
tccgagggaggcttcatctgggcctgtaagaattacgatggggatgtgcagtcagactca
gtcgcccaaggttatggctcccttggcatgatgaccagtgtgctgatttgtccagatggt
aagacggtagaagcagaggctgcccatggcactgtcacacgtcactaccgcatgtaccag
aaagggcaagagacgtccaccaaccccattgcttccatttttgcctggtcccgagggtta
gcccacagagcaaagcttgataacaatactgagctcagcttcttcgcaaaggctttggaa
gacgtctgcattgagaccattgaggctggctttatgactaaggacttggctgcttgcatt
aaaggcttacccaatgtacaacgttctgactacttgaatacatttgagtttatggacaaa
cttggagaaaacttgaaggccaaattagctcaggccaaactttaa

DBGET integrated database retrieval system