KEGG   Mus musculus (mouse): 15930Help
Entry
15930             CDS       T01002                                 

Gene name
Ido1, Ido, Indo
Definition
(RefSeq) indoleamine 2,3-dioxygenase 1 (EC:1.13.11.52)
  KO
K00463  
indoleamine 2,3-dioxygenase [EC:1.13.11.52]
Organism
mmu  Mus musculus (mouse)
Pathway
Tryptophan metabolism
Metabolic pathways
African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    15930 (Ido1)
 Human Diseases
  Infectious diseases
   05143 African trypanosomiasis
    15930 (Ido1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.52  indoleamine 2,3-dioxygenase
     15930 (Ido1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8; 8 A2
AA seq 407 aa AA seqDB search
MALSKISPTEGSRRILEDHHIDEDVGFALPHPLVELPDAYSPWVLVARNLPVLIENGQLR
EEVEKLPTLSTDGLRGHRLQRLAHLALGYITMAYVWNRGDDDVRKVLPRNIAVPYCELSE
KLGLPPILSYADCVLANWKKKDPNGPMTYENMDILFSFPGGDCDKGFFLVSLLVEIAASP
AIKAIPTVSSAVERQDLKALEKALHDIATSLEKAKEIFKRMRDFVDPDTFFHVLRIYLSG
WKCSSKLPEGLLYEGVWDTPKMFSGGSAGQSSIFQSLDVLLGIKHEAGKESPAEFLQEMR
EYMPPAHRNFLFFLESAPPVREFVISRHNEDLTKAYNECVNGLVSVRKFHLAIVDTYIMK
PSKKKPTDGDKSEEPSNVESRGTGGTNPMTFLRSVKDTTEKALLSWP
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagtaaaatatctcctacagaaggttctagaaggatccttgaagaccaccac
atagatgaagatgtgggctttgctctaccacatccactggtggagctgcccgacgcatac
agcccctgggtccttgtggctagaaatctgcctgtgctgattgagaacgggcagcttcga
gaagaagttgaaaagctgcccacactgagcacggacggactgagaggacacaggttacag
cgcctggcacacctggccctggggtacatcaccatggcgtatgtgtggaaccgaggggat
gacgatgttcgaaaggtgctgccccgcaatattgctgttccctactgcgagctctcagag
aagttgggcctgcctcctattctgtcttatgcagactgtgtcctggcaaactggaagaaa
aaggaccccaatgggcccatgacatacgagaacatggacattctgttctcatttcctggt
ggggactgcgacaagggcttcttcctcgtctctctattggtggaaatcgcagcttctcct
gcaatcaaagcaatccccactgtatccagtgcagtagagcgtcaagacctgaaagcattg
gaaaaggcactgcacgacatagctaccagtctggagaaagccaaggaaatttttaagagg
atgcgtgactttgtggacccagacacgtttttccacgttctccgcatatatctgtctggc
tggaaatgcagctccaagctgccagaaggtctgctgtatgagggggtctgggacacccca
aaaatgttttcagggggcagtgcaggccagagcagcatcttccagagtcttgatgtcctt
ctgggaataaaacacgaggctggcaaagaatctcctgcagaattcctccaggaaatgaga
gagtacatgcctccagcccaccggaacttccttttcttcttagagtcagctcccccagtc
cgtgagtttgtcatttcaagacacaatgaagacttgacgaaagcttataacgagtgtgtg
aatggtctggtctctgtgagaaagttccacctcgcaatagtagatacttacattatgaaa
ccttcgaagaagaagcccactgatggcgacaagtcggaagagccctcaaatgtggaaagc
agagggactgggggtacgaatcccatgactttcctaaggagtgtgaaagatacaaccgag
aaagctcttctgagttggccttag

DBGET integrated database retrieval system