KEGG   Mus musculus (mouse): 15945Help
Entry
15945             CDS       T01002                                 

Gene name
Cxcl10, C7, CRG-2, INP10, IP-10, IP10, Ifi10, Scyb10, gIP-10, mob-1
Definition
chemokine (C-X-C motif) ligand 10
Orthology
K12671  
C-X-C motif chemokine 10
Organism
mmu  Mus musculus (mouse)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
TNF signaling pathway
Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    15945 (Cxcl10)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15945 (Cxcl10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    15945 (Cxcl10)
   04622 RIG-I-like receptor signaling pathway
    15945 (Cxcl10)
   04623 Cytosolic DNA-sensing pathway
    15945 (Cxcl10)
   04062 Chemokine signaling pathway
    15945 (Cxcl10)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    15945 (Cxcl10)
Heparan sulfate/heparin binding proteins [BR:mmu00536]
 Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
  15945 (Cxcl10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5 E2; 5 46.57 cM
AA seq 98 aa AA seqDB search
MNPSAAVIFCLILLGLSGTQGIPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRV
EIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaagtgctgccgtcattttctgcctcatcctgctgggtctgagtgggactcaa
gggatccctctcgcaaggacggtccgctgcaactgcatccatatcgatgacgggccagtg
agaatgagggccatagggaagcttgaaatcatccctgcgagcctatcctgcccacgtgtt
gagatcattgccacgatgaaaaagaatgatgagcagagatgtctgaatccggaatctaag
accatcaagaatttaatgaaagcgtttagccaaaaaaggtctaaaagggctccttaa

DBGET integrated database retrieval system