KEGG   Mus musculus (mouse): 15945Help
Entry
15945             CDS       T01002                                 

Gene name
Cxcl10, C7, CRG-2, INP10, IP-10, IP10, Ifi10, Scyb10, gIP-10, mob-1
Definition
chemokine (C-X-C motif) ligand 10
Orthology
K12671  
C-X-C motif chemokine 10
Organism
mmu  Mus musculus (mouse)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
TNF signaling pathway
Influenza A
Class
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:mmu04668]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:mmu04060]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:mmu04620]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:mmu04622]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:mmu04623]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:mmu04062]
Human Diseases; Infectious diseases; Influenza A [PATH:mmu05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5 E2; 5 46.57 cM
AA seq 98 aa AA seqDB search
MNPSAAVIFCLILLGLSGTQGIPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRV
EIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaagtgctgccgtcattttctgcctcatcctgctgggtctgagtgggactcaa
gggatccctctcgcaaggacggtccgctgcaactgcatccatatcgatgacgggccagtg
agaatgagggccatagggaagcttgaaatcatccctgcgagcctatcctgcccacgtgtt
gagatcattgccacgatgaaaaagaatgatgagcagagatgtctgaatccggaatctaag
accatcaagaatttaatgaaagcgtttagccaaaaaaggtctaaaagggctccttaa

DBGET integrated database retrieval system