KEGG   Mus musculus (mouse): 15985Help
Entry
15985             CDS       T01002                                 

Gene name
Cd79b, B29, Ig-beta, Igb, Igbeta
Definition
(RefSeq) CD79B antigen
  KO
K06507  CD79B antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04662 B cell receptor signaling pathway
    15985 (Cd79b)
CD molecules [BR:mmu04090]
 Proteins
  15985 (Cd79b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set I-set Ig_3 ITAM ig Ig_2 Sigma_reg_N
Motif
Other DBs
NCBI-GeneID: 15985
NCBI-ProteinID: NP_032365
MGI: 96431
Ensembl: ENSMUSG00000040592
UniProt: P15530
Structure
PDB: 

Jmol
Position
11 E1; 11 68.89 cM
AA seq 228 aa AA seqDB search
MATLVLSSMPCHWLLFLLLLFSGEPVPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSM
VKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFC
KQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLL
DKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggccacactggtgctgtcttccatgccctgccactggctgttgttcctgctgctgctc
ttctcaggtgagccggtaccagcaatgacaagcagtgacctgccactgaatttccaagga
agcccttgttcccagatctggcagcacccgaggtttgcagccaaaaagcggagctccatg
gtgaagtttcactgctacacaaaccactcaggtgcactgacctggttccgaaagcgaggg
agccagcagccccaggaactggtctcagaagagggacgcattgtgcagacccagaatggc
tctgtctacaccctcactatccaaaacatccagtacgaggataatggtatctacttctgc
aagcagaaatgtgacagcgccaaccataatgtcaccgacagctgtggcacggaacttcta
gtcttaggattcagcacgttggaccaactgaagcggcggaacacactgaaagatggcatt
atcttgatccagaccctcctcatcatcctcttcatcattgtgcccatcttcctgctactt
gacaaggatgacggcaaggctgggatggaggaagatcacacctatgagggcttgaacatt
gaccagacagccacctatgaagacatagtgactcttcggacaggggaggtaaagtggtcg
gtaggagagcatccaggccaggaatga

DBGET integrated database retrieval system