KEGG   Mus musculus (mouse): 16001Help
Entry
16001             CDS       T01002                                 

Gene name
Igf1r, A330103N21Rik, CD221, D930020L01, IGF-1R, hyft
Definition
(RefSeq) insulin-like growth factor I receptor (EC:2.7.10.1)
  KO
K05087  
insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
EGFR tyrosine kinase inhibitor resistance
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Oocyte meiosis
Endocytosis
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Focal adhesion
Adherens junction
Signaling pathways regulating pluripotency of stem cells
Long-term depression
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
Glioma
Prostate cancer
Melanoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    16001 (Igf1r)
   04015 Rap1 signaling pathway
    16001 (Igf1r)
   04066 HIF-1 signaling pathway
    16001 (Igf1r)
   04068 FoxO signaling pathway
    16001 (Igf1r)
   04151 PI3K-Akt signaling pathway
    16001 (Igf1r)
   04152 AMPK signaling pathway
    16001 (Igf1r)
   04150 mTOR signaling pathway
    16001 (Igf1r)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    16001 (Igf1r)
  Cell growth and death
   04114 Oocyte meiosis
    16001 (Igf1r)
  Cellular commiunity
   04510 Focal adhesion
    16001 (Igf1r)
   04520 Adherens junction
    16001 (Igf1r)
   04550 Signaling pathways regulating pluripotency of stem cells
    16001 (Igf1r)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    16001 (Igf1r)
   04914 Progesterone-mediated oocyte maturation
    16001 (Igf1r)
  Nervous system
   04730 Long-term depression
    16001 (Igf1r)
  Aging
   04211 Longevity regulating pathway - mammal
    16001 (Igf1r)
   04213 Longevity regulating pathway - multiple species
    16001 (Igf1r)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    16001 (Igf1r)
   05202 Transcriptional misregulation in cancers
    16001 (Igf1r)
   05205 Proteoglycans in cancer
    16001 (Igf1r)
   05214 Glioma
    16001 (Igf1r)
   05218 Melanoma
    16001 (Igf1r)
   05215 Prostate cancer
    16001 (Igf1r)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    16001 (Igf1r)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     16001 (Igf1r)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  InsR family [OT]
   16001 (Igf1r)
Enzyme-linked receptors [BR:mmu01020]
 Receptor tyrosine kinases
  RTK class II (Insulin receptor family)
   16001 (Igf1r)
Cytokine receptors [BR:mmu04050]
 Receptor tyrosine kinase
  RTK class II (Insulin receptor family)
   16001 (Igf1r)
Cellular antigens [BR:mmu04090]
 Proteins
  16001 (Igf1r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 D1; 7 37.27 cM
AA seq 1369 aa AA seqDB search
MKSGSGGGSPTSLWGLVFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGFLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTIDWSLILDAVSNNYIVGNKPPKECGD
LCPGTLEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSVCGKRACTENNECCHPECLGSCH
TPDDNTTCVACRHYYYKGVCVPACPPGTYRFEGWRCVDRDFCANIPNAESSDSDGFVIHD
DECMQECPSGFIRNSTQSMYCIPCEGPCPKVCGDEEKKTKTIDSVTSAQMLQGCTILKGN
LLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYS
FYVLDNQNLQQLWDWNHRNLTVRSGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINT
RNNGERASCESDVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYD
GQDACGSNSWNMVDVDLPPNKEGEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKS
EILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPTLPNGNLSYYIVRWQRQPQDGYLYR
HNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGDKGPCCACPKTEAEKQAEKEEAEYR
KVFENFLHNSIFVPRPERRRRDVMQVANTTMSSRSRNTTVADTYNITDPEEFETEYPFFE
SRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVT
WEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPG
NYTARIQATSLSGNGSWTDPVFFYVPAKTTYENFMHLIIALPVAILLIVGGLVIMLYVFH
RKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMNRELGQGSFGMVYEGVAK
GVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIM
ELMTRGDLKSYLRSLRPEVEQNNLVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAA
RNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSF
GVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPS
FLEIIGSIKDEMEPSFQEVSFYYSEENKPPEPEELEMEPENMESVPLDPSASSASLPLPE
RHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRANERALPLPQSSTC
NT seq 4110 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcgtgtttctctcc
gccgcgctctctctctggccgacgagtggagaaatctgtgggcccggcattgacatccgc
aacgactatcagcagctgaagcgcctggaaaactgcacggtgatcgagggcttcctccac
atcctgctcatctccaaggccgaggactaccgaagctaccgcttccccaagctcaccgtc
atcactgagtacttgctgctcttccgagtcgctggcctcgagagcctgggagacctcttc
cccaacctcacagtcatccgtggctggaaactcttctacaactacgcactggtcatcttc
gagatgaccaatctcaaggatattgggctttataatctgaggaacattactcggggggcc
atcaggattgagaagaacgccgacctctgttacctctccaccatagactggtctctcatc
ttggatgcggtgtccaataactacattgtggggaacaagcccccgaaggaatgtggggac
ctgtgtccagggacattggaggagaagcccatgtgtgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaatcgctgccagaaaatgtgcccaagtgtgtgcggg
aagcgagcctgcaccgagaacaacgagtgctgccacccggagtgcctgggcagctgccac
acaccggacgacaacacaacctgcgtggcctgcagacactactactacaaaggcgtgtgt
gtgcctgcctgcccgcctggcacctacaggttcgagggctggcgctgtgtggatcgcgat
ttctgcgccaacatccccaacgctgagagcagtgactcggatggcttcgttatccacgac
gatgagtgcatgcaggagtgtccctcaggcttcatccgcaacagcacccagagcatgtac
tgtatcccctgcgaaggcccctgccccaaagtctgcggcgatgaagagaagaaaacgaaa
accatcgattcggtgacttctgctcaaatgctccaaggatgcaccatcctgaagggcaat
ctgcttattaacatccggagaggcaataacattgcctcggagttggagaacttcatgggg
ctcatcgaggtggtgaccggctacgtgaagatccgccattctcatgccttggtctccttg
tccttcctgaagaaccttcgtctcatcttaggagaggagcagctggaagggaactactcc
ttctatgtcctagacaaccagaacttgcagcagctgtgggactggaaccaccggaacctg
accgtcaggtccggaaagatgtactttgctttcaatcccaagctgtgtgtctccgaaatt
taccgcatggaggaagtgaccggaaccaagggacgccagagcaaaggggacataaacacc
aggaacaacggagagcgagcttcctgtgaaagtgatgttctccgtttcacctccaccacg
acctggaagaaccgaatcatcataacgtggcaccggtaccggccgccggactaccgggat
ctcatcagcttcacagtttactacaaggaggcaccatttaaaaacgttacggaatatgac
gggcaggatgcctgtggctccaacagctggaacatggtggatgtagacctgcctccgaac
aaggagggcgagcctggcattttactgcatgggctgaagccctggacccagtatgctgtc
tatgtcaaggctgtgaccctcaccatggtggaaaacgaccatatccgtggggccaaaagt
gaaatcttgtacattcgcaccaatgcttcagtcccttccattcccctagatgtcctctca
gcatcaaactcttcctctcagctgattgtgaagtggaatcctccaactctgcccaatggt
aacttgagttactacattgtgaggtggcagcggcagccccaggatggttacctgtaccgg
cacaactactgctccaaagacaaaatacccatcagaaagtacgccgatggtaccatcgac
gtggaggaggtgacggaaaatcccaagacagaagtgtgtggtggtgataaagggccatgc
tgcgcttgccctaaaactgaagctgagaagcaggctgagaaggaggaggctgagtaccgt
aaagtctttgagaatttccttcacaattccatctttgtgcccaggcccgaaaggaggcgg
agagacgtcatgcaagtggccaacacgaccatgtccagccgaagcaggaacaccacggta
gctgacacctacaatatcacagacccggaggagttcgagacagagtaccctttctttgag
agcagagtggataacaaggagaggactgtcatctccaacctccggcctttcactctgtac
cgcatcgatatccacagctgcaaccacgaggctgagaagctgggctgcagcgcctccaac
ttcgtctttgcgagaaccatgccagcagaaggagcagatgatatccctggtccggtgacc
tgggagccaagacccgaaaactccatctttttaaagtggccagaacccgagaaccccaac
ggattgatcctaatgtatgaaattaaatacgggtcgcaagtcgaggatcagcgggaatgt
gtgtccagacaggagtacaggaagtacggaggggccaaactcaaccgtctaaacccaggg
aactatacagcccggattcaggctacctccctctctgggaatgggtcatggacagatcct
gtgttcttctatgtccccgccaaaacgacgtatgagaacttcatgcatctgatcattgct
ctgccggttgccatcctgctgatcgttggggggctggttatcatgctgtatgtcttccat
agaaagagaaataacagcaggttgggcaatggagtgctgtatgcttctgtgaaccccgag
tatttcagcgcagctgatgtgtacgtgcctgatgaatgggaggtagctcgagagaagatc
accatgaaccgggagctcggacaagggtcctttgggatggtctatgaaggagtggccaag
ggtgtggtcaaggatgaacccgaaaccagagtggccatcaagacggtaaacgaggctgca
agtatgcgtgaaagaatcgagtttctcaacgaggcctcggtgatgaaggagttcaattgt
caccatgtggtccggttgctgggtgtggtatcccaaggccagcccaccctggtcatcatg
gaactaatgacacgcggtgatctcaaaagttatctccggtctctgaggccagaagtggag
cagaataatctagtcctcattcctccgagcttaagcaagatgatccagatggctggagag
attgcagatggcatggcctacctcaatgccaacaagttcgtccacagagaccttgctgct
aggaactgcatggtagccgaagatttcacagtcaaaattggagatttcggtatgacacga
gacatctacgagacggactactaccggaaaggcgggaaggggttgctgcctgtgcgctgg
atgtctcccgagtccctcaaggatggtgtcttcactactcattctgatgtctggtccttc
ggggtcgtcctctgggagatcgccacgctggctgagcagccctaccagggcttgtccaac
gagcaagttcttcgtttcgtcatggagggtggccttctggacaagccggacaactgccct
gatatgctgtttgaacttatgcgcatgtgctggcagtataaccccaagatgcggccctcc
ttcctggagatcatcggcagcatcaaggatgagatggagcccagcttccaggaggtctcc
ttctactacagcgaggagaacaagcctcccgagccagaggagctggagatggagcctgag
aacatggagagcgtcccactggacccttcggcctcctcagcctccctgcctctgcctgaa
agacactcaggacacaaggctgagaatggcccgggccctggcgtgctcgttctccgcgcc
agttttgatgagagacagccttacgctcacatgaacgggggacgcgccaacgagagggcc
ttgcctctgccccagtcctcgacctgctga

DBGET integrated database retrieval system