KEGG   Mus musculus (mouse): 16011Help
Entry
16011             CDS       T01002                                 

Gene name
Igfbp5, AI256729, AW208790, IGFBP-5, IGFBP-5P
Definition
(RefSeq) insulin-like growth factor binding protein 5
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 C3; 1 36.94 cM
AA seq 271 aa AA seqDB search
MVISVVLLLLAAYAVPAQGLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCAL
AEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYGEQTKIERDSREHEE
PTTSEMAEETYSPKVFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRVIPAP
EMRQESEQGPCRRHMEASLQEFKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGIC
WCVDKYGMKLPGMEYVDGDFQCHAFDSSNVE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcagcgtggtcctcctgctgctggccgcctatgccgtaccggctcaaggcctg
ggttctttcgtgcactgtgaaccctgcgacgagaaagctctgtccatgtgtccccccagc
cctctgggctgtgagctggtcaaagagcccggctgtggctgctgcatgacttgcgccctg
gcggagggacagtcgtgtggcgtctacacggagcgctgcgcccagggtttgcgctgcctc
ccccggcaggatgaggagaagccgctgcacgccctgctgcacggccgcggggtttgcctc
aacgaaaagagctacggcgagcaaaccaagatagagagagactctcgggaacacgaggaa
cccaccacctccgagatggctgaagagacctactcccccaaggtcttccggcccaagcac
actcgcatttccgagctgaaggctgaggctgtgaagaaggaccgcagaaagaagctgacc
cagtccaagtttgtggggggtgcagagaacactgcccaccccagagtcatccctgcacct
gagatgagacaggaatccgaacaaggcccctgccgcagacacatggaagcttccctccag
gagttcaaagccagcccacgcatggtgccccgtgctgtgtacctgcccaactgtgaccgc
aaaggattctacaagagaaagcagtgtaagccctcccgtggccgcaaacgtggcatctgc
tggtgtgtggacaagtacggaatgaagctgccgggcatggagtacgtggatggggacttt
cagtgccacgccttcgacagcagtaacgttgagtga

DBGET integrated database retrieval system