KEGG   Mus musculus (mouse): 16149Help
Entry
16149             CDS       T01002                                 

Gene name
Cd74, CLIP, DHLAG, HLADG, Ia-GAMMA, Ii
Definition
(RefSeq) CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)
  KO
K06505  
CD74 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
Antigen processing and presentation
Tuberculosis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    16149 (Cd74)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    16149 (Cd74)
   05168 Herpes simplex infection
    16149 (Cd74)
Cellular antigens [BR:mmu04090]
 Proteins
  16149 (Cd74)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Others
   16149 (Cd74)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
18 E1; 18 34.41 cM
AA seq 279 aa AA seqDB search
MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLAGQATTAYFLYQQQGR
LDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNM
TQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSL
EEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNG
TEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggatgaccaacgcgacctcatctctaaccatgaacagttgcccatactgggcaaccgc
cctagagagccagaaaggtgcagccgtggagctctgtacaccggtgtctctgtcctggtg
gctctgctcttggctgggcaggccaccactgcttacttcctgtaccagcaacagggccgc
ctagacaagctgaccatcacctcccagaacctgcaactggagagccttcgcatgaagctt
ccgaaatctgccaaacctgtgagccagatgcggatggctactcccttgctgatgcgtcca
atgtccatggataacatgctccttgggcctgtgaagaacgttaccaagtacggcaacatg
acccaggaccatgtgatgcatctgctcacgaggtctggacccctggagtacccgcagctg
aaggggaccttcccagagaatctgaagcatcttaagaactccatggatggcgtgaactgg
aagatcttcgagagctggatgaagcagtggctcttgtttgagatgagcaagaactccctg
gaggagaagaagcccaccgaggctccacctaaagtactgaccaagtgccaggaagaagtc
agccacatccctgccgtctacccgggtgcgttccgtcccaagtgcgacgagaacggtaac
tatttgccactccagtgccacgggagcactggctactgctggtgtgtgttccccaacggc
actgaggttcctcacaccaagagccgcgggcgccataactgcagtgagccactggacatg
gaagacctatcttctggcctgggagtgaccaggcaggaactgggtcaagtcaccctgtga

DBGET integrated database retrieval system