KEGG   Mus musculus (mouse): 16160Help
Entry
16160             CDS       T01002                                 

Gene name
Il12b, Il-12b, Il-12p40, Il12p40, p40
Definition
(RefSeq) interleukin 12b
  KO
K05425  
interleukin 12B
Organism
mmu  Mus musculus (mouse)
Pathway
Cytokine-cytokine receptor interaction
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Jak-STAT signaling pathway
Type I diabetes mellitus
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Toxoplasmosis
Amoebiasis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Proteoglycans in cancer
Inflammatory bowel disease (IBD)
Allograft rejection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    16160 (Il12b)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16160 (Il12b)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    16160 (Il12b)
   04622 RIG-I-like receptor signaling pathway
    16160 (Il12b)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    16160 (Il12b)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    16160 (Il12b)
   05330 Allograft rejection
    16160 (Il12b)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    16160 (Il12b)
  Infectious diseases
   05133 Pertussis
    16160 (Il12b)
   05134 Legionellosis
    16160 (Il12b)
   05152 Tuberculosis
    16160 (Il12b)
   05162 Measles
    16160 (Il12b)
   05164 Influenza A
    16160 (Il12b)
   05168 Herpes simplex infection
    16160 (Il12b)
   05146 Amoebiasis
    16160 (Il12b)
   05145 Toxoplasmosis
    16160 (Il12b)
   05140 Leishmaniasis
    16160 (Il12b)
   05142 Chagas disease (American trypanosomiasis)
    16160 (Il12b)
   05143 African trypanosomiasis
    16160 (Il12b)
Cytokines [BR:mmu04052]
 Class I cytokines (hematopoietin family)
  IL-6 receptor family
   16160 (Il12b)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Cytokines (General comment) Chemotaxis, singal transduction, inflammation
   16160 (Il12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
11 25.94 cM; 11 A5-B2
AA seq 335 aa AA seqDB search
MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITW
TSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNF
KNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLD
QRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQ
MKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTS
TEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcctcagaagctaaccatctcctggtttgccatcgttttgctggtgtctccactc
atggccatgtgggagctggagaaagacgtttatgttgtagaggtggactggactcccgat
gcccctggagaaacagtgaacctcacctgtgacacgcctgaagaagatgacatcacctgg
acctcagaccagagacatggagtcataggctctggaaagaccctgaccatcactgtcaaa
gagtttctagatgctggccagtacacctgccacaaaggaggcgagactctgagccactca
catctgctgctccacaagaaggaaaatggaatttggtccactgaaattttaaaaaatttc
aaaaacaagactttcctgaagtgtgaagcaccaaattactccggacggttcacgtgctca
tggctggtgcaaagaaacatggacttgaagttcaacatcaagagcagtagcagttcccct
gactctcgggcagtgacatgtggaatggcgtctctgtctgcagagaaggtcacactggac
caaagggactatgagaagtattcagtgtcctgccaggaggatgtcacctgcccaactgcc
gaggagaccctgcccattgaactggcgttggaagcacggcagcagaataaatatgagaac
tacagcaccagcttcttcatcagggacatcatcaaaccagacccgcccaagaacttgcag
atgaagcctttgaagaactcacaggtggaggtcagctgggagtaccctgactcctggagc
actccccattcctacttctccctcaagttctttgttcgaatccagcgcaagaaagaaaag
atgaaggagacagaggaggggtgtaaccagaaaggtgcgttcctcgtagagaagacatct
accgaagtccaatgcaaaggcgggaatgtctgcgtgcaagctcaggatcgctattacaat
tcctcatgcagcaagtgggcatgtgttccctgcagggtccgatcctag

DBGET integrated database retrieval system