KEGG   Mus musculus (mouse): 16176Help
Entry
16176             CDS       T01002                                 

Gene name
Il1b, IL-1beta, Il-1b
Definition
(RefSeq) interleukin 1 beta
  KO
K04519  
interleukin 1 beta
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hematopoietic cell lineage
TNF signaling pathway
Inflammatory mediator regulation of TRP channels
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Type I diabetes mellitus
Alzheimer's disease
Prion diseases
Salmonella infection
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Amoebiasis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    16176 (Il1b)
   04064 NF-kappa B signaling pathway
    16176 (Il1b)
   04668 TNF signaling pathway
    16176 (Il1b)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16176 (Il1b)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    16176 (Il1b)
   04620 Toll-like receptor signaling pathway
    16176 (Il1b)
   04621 NOD-like receptor signaling pathway
    16176 (Il1b)
   04623 Cytosolic DNA-sensing pathway
    16176 (Il1b)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    16176 (Il1b)
  Development
   04380 Osteoclast differentiation
    16176 (Il1b)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    16176 (Il1b)
   05321 Inflammatiory bowel disease (IBD)
    16176 (Il1b)
   05332 Graft-versus-host disease
    16176 (Il1b)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    16176 (Il1b)
   05020 Prion diseases
    16176 (Il1b)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    16176 (Il1b)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    16176 (Il1b)
   04933 AGE-RAGE signaling pathway in diabetic complications
    16176 (Il1b)
  Infectious diseases
   05132 Salmonella infection
    16176 (Il1b)
   05133 Pertussis
    16176 (Il1b)
   05134 Legionellosis
    16176 (Il1b)
   05152 Tuberculosis
    16176 (Il1b)
   05162 Measles
    16176 (Il1b)
   05164 Influenza A
    16176 (Il1b)
   05168 Herpes simplex infection
    16176 (Il1b)
   05146 Amoebiasis
    16176 (Il1b)
   05144 Malaria
    16176 (Il1b)
   05140 Leishmaniasis
    16176 (Il1b)
   05142 Chagas disease (American trypanosomiasis)
    16176 (Il1b)
   05143 African trypanosomiasis
    16176 (Il1b)
Cytokines [BR:mmu04052]
 IL-1 family
  16176 (Il1b)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Cytokines (General comment) Chemotaxis, singal transduction, inflammation
   16176 (Il1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2 62.97 cM; 2 F
AA seq 269 aa AA seqDB search
MATVPELNCEMPPFDSDENDLFFEVDGPQKMKGCFQTFDLGCPDESIQLQISQQHINKSF
RQAVSLIVAVEKLWQLPVSFPWTFQDEDMSTFFSFIFEEEPILCDSWDDDDNLLVCDVPI
RQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLK
GKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYIS
TSQAEHKPVFLGNNSGQDIIDFTMESVSS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgttcctgaactcaactgtgaaatgccaccttttgacagtgatgagaatgac
ctgttctttgaagttgacggaccccaaaagatgaagggctgcttccaaacctttgacctg
ggctgtcctgatgagagcatccagcttcaaatctcgcagcagcacatcaacaagagcttc
aggcaggcagtatcactcattgtggctgtggagaagctgtggcagctacctgtgtctttc
ccgtggaccttccaggatgaggacatgagcaccttcttttccttcatctttgaagaagag
cccatcctctgtgactcatgggatgatgatgataacctgctggtgtgtgacgttcccatt
agacaactgcactacaggctccgagatgaacaacaaaaaagcctcgtgctgtcggaccca
tatgagctgaaagctctccacctcaatggacagaatatcaaccaacaagtgatattctcc
atgagctttgtacaaggagaaccaagcaacgacaaaatacctgtggccttgggcctcaaa
ggaaagaatctatacctgtcctgtgtaatgaaagacggcacacccaccctgcagctggag
agtgtggatcccaagcaatacccaaagaagaagatggaaaaacggtttgtcttcaacaag
atagaagtcaagagcaaagtggagtttgagtctgcagagttccccaactggtacatcagc
acctcacaagcagagcacaagcctgtcttcctgggaaacaacagtggtcaggacataatt
gacttcaccatggaatccgtgtcttcctaa

DBGET integrated database retrieval system