KEGG   Mus musculus (mouse): 16179Help
Entry
16179             CDS       T01002                                 

Gene name
Irak1, AA408924, IRAK, IRAK-1, IRAK1-S, IRAK1b, Il1rak, Plpk, mPLK
Definition
(RefSeq) interleukin-1 receptor-associated kinase 1 (EC:2.7.11.1)
  KO
K04730  
interleukin-1 receptor-associated kinase 1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
Neurotrophin signaling pathway
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Measles
Epstein-Barr virus infection
Module
Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    16179 (Irak1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    16179 (Irak1)
  Nervous system
   04722 Neurotrophin signaling pathway
    16179 (Irak1)
 Human Diseases
  Infectious diseases
   05133 Pertussis
    16179 (Irak1)
   05152 Tuberculosis
    16179 (Irak1)
   05162 Measles
    16179 (Irak1)
   05169 Epstein-Barr virus infection
    16179 (Irak1)
   05145 Toxoplasmosis
    16179 (Irak1)
   05140 Leishmaniasis
    16179 (Irak1)
   05142 Chagas disease (American trypanosomiasis)
    16179 (Irak1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     16179 (Irak1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: TKL group
  IRAK family
   16179 (Irak1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X A7.3; X 37.61 cM
AA seq 710 aa AA seqDB search
MAGGPGPGEPVVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPVVPPSTAAPRPSS
ISAGSEAGDWSPRKLQSSASTFLSPAFPGSQTHSESELLQVPLPVSLGPPLPSSAPSSTK
SSPESPVSGLQRAHPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKR
LKEEADLEWTMVKQSFLTEVEQLSRFRHPNIVDFAGYCAESGLYCLVYGFLPNGSLEDQL
HLQTQACSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLMPKLGDFG
LARFSRFAGAKASQSSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVILETLAG
QRAVRTQGAKTKYLKDLIEDEAEEAGVTLKSTQPTLWVGVATDAWAAPIAAQIYKKHLDS
RPGPCPPQLGLALAQLACCCMHRRAKKRPPMTQVYKRLEGLQAGPPWELEVAGHGSPSPQ
ENSYMSTTGSAQSGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLSATLHSWH
LTPGSHPSPASFREASCTQGGTTRESSVRSSPGFQPTTMEGSPTGSSSLLSSEPPQIIIN
PARQKMVQKLALYEEGVLDSLQLLSSGFFPGLDLEPEKSQGPEESDEFQS
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggccggggggccgggccccggggagcctgtggttccaggcgcccagcacttcttgtac
gaggtgccaccctgggttatgtgccgcttctacaaagtgatggacgccctggagcccgcc
gactggtgccagttcgcggccttgatcgtgcgcgaccagacagagctgcggctgtgcgag
cgctccgagcagcgcacagccagtgttctgtggccctggatcaaccgcaacgcgcgcgta
gctgacctcgttcacatcctcacgcacctgcagctgctgcgtgcgagggacatcatcaca
gcctggcaccctcctgcccccgttgtgcccccaagcaccgctgccccaaggcccagcagc
atctctgcaggctctgaggccggggactggagcccccggaaattgcagtcctctgcctcc
accttcctctccccagcttttccaggctcccagacccattctgagtcagagctcctccag
gttccactccctgtttccctcgggccaccactaccatcttcagccccttcctccaccaag
tcaagcccagagagcccagtgtctggcctccaaagagcccatccctccccgttttgctgg
cccttctgtgagatttcccaaggcacctgcaacttctctgaagaactcaggattggagag
ggtggttttggatgtgtgtaccgagcagtcatgagaaatactacatatgctgtgaagaga
ctgaaggaggaagctgacctagagtggactatggtgaaacagagcttcttaacagaggtg
gaacagctatcaaggtttcgtcacccaaatatcgtagactttgctggctactgtgcagag
agtggcttatactgccttgtttatggcttcttgcccaatggctccttggaggatcagctc
caccttcagacccaggcctgctccccactttcctggcctcaacgactggacattcttctg
ggcacagcccgggctattcagtttttacatcaggatagccccagccttatccatggagac
atcaagagttctaacgtgcttctggatgagagactgatgcccaagctgggagactttggc
ctggctcgtttcagccgctttgcgggggccaaagcaagccagagcagtactgtggcccgg
acttccacagttcgaggtaccctcgcctacttgcctgaggagtacatcaagacaggccga
ctggctgtggacaccgataccttcagctttggggtggtaatactggagacccttgctggt
cagagggctgtgaggacacaaggtgcaaagaccaagtatttgaaagacctgattgaagat
gaggctgaagaggctggagtgaccctgaaaagcacccagcctactctgtgggtgggtgta
gccacggatgcttgggctgctccaattgctgcccagatctataagaagcacctggactcc
agacctgggccctgcccaccccagttgggcctggccctggctcaactagcttgctgctgc
atgcaccgtcgggccaagaagaggccccccatgacccaggtatacaagagactagaaggg
cttcaggcagggcctccctgggagctagaggttgccggccatggctccccttccccacag
gagaactcctacatgtctaccactggcagtgcccagagtggggatgaaccatggcagcct
ctagtagtgaccacaagagccccagcccaggctgcccagcaactccagagaagtcccaac
cagccagtggaaagtgatgagagtgttcccggcctctctgctaccctgcattcctggcac
ttgactccaggttcccacccaagcccagcgtccttcagagaggctagctgtacccaggga
ggcactaccagagaatcaagtgtgaggagtagcccaggcttccagcctacaaccatggaa
ggctcacccacgggcagctcatccctgctgtcatcagaaccaccacagatcatcatcaac
ccagcccgacagaagatggtacaaaagctggctctttatgaagaaggggtcttggatagc
ctgcaactgctgtcatcaggctttttcccaggcttggatttagaacctgaaaagagccag
ggacctgaagaaagtgatgaattccagagctga

DBGET integrated database retrieval system