KEGG   Mus musculus (mouse): 16193Help
Entry
16193             CDS       T01002                                 

Gene name
Il6, Il-6
Definition
interleukin 6
Orthology
K05405  
interleukin 6
Organism
mmu  Mus musculus (mouse)
Pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
TNF signaling pathway
Intestinal immune network for IgA production
Non-alcoholic fatty liver disease (NAFLD)
Prion diseases
Salmonella infection
Pertussis
Legionellosis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Amoebiasis
Tuberculosis
Hepatitis B
Measles
Influenza A
HTLV-I infection
Herpes simplex infection
Pathways in cancer
Transcriptional misregulation in cancer
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Graft-versus-host disease
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    16193 (Il6)
   04668 TNF signaling pathway
    16193 (Il6)
   04066 HIF-1 signaling pathway
    16193 (Il6)
   04068 FoxO signaling pathway
    16193 (Il6)
   04151 PI3K-Akt signaling pathway
    16193 (Il6)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16193 (Il6)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    16193 (Il6)
   04620 Toll-like receptor signaling pathway
    16193 (Il6)
   04621 NOD-like receptor signaling pathway
    16193 (Il6)
   04623 Cytosolic DNA-sensing pathway
    16193 (Il6)
   04672 Intestinal immune network for IgA production
    16193 (Il6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    16193 (Il6)
   05202 Transcriptional misregulation in cancers
    16193 (Il6)
  Immune diseases
   05323 Rheumatoid arthritis
    16193 (Il6)
   05321 Inflammatiory bowel disease (IBD)
    16193 (Il6)
   05332 Graft-versus-host disease
    16193 (Il6)
  Neurodegenerative diseases
   05020 Prion diseases
    16193 (Il6)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    16193 (Il6)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    16193 (Il6)
  Infectious diseases
   05132 Salmonella infection
    16193 (Il6)
   05133 Pertussis
    16193 (Il6)
   05134 Legionellosis
    16193 (Il6)
   05152 Tuberculosis
    16193 (Il6)
   05166 HTLV-I infection
    16193 (Il6)
   05162 Measles
    16193 (Il6)
   05164 Influenza A
    16193 (Il6)
   05161 Hepatitis B
    16193 (Il6)
   05168 Herpes simplex infection
    16193 (Il6)
   05146 Amoebiasis
    16193 (Il6)
   05144 Malaria
    16193 (Il6)
   05142 Chagas disease (American trypanosomiasis)
    16193 (Il6)
   05143 African trypanosomiasis
    16193 (Il6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
5 B1; 5 15.7 cM
AA seq 211 aa AA seqDB search
MKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLW
EIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEY
HSYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLES
QKEWLRTKTIQFILKSLEEFLKVTLRSTRQT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctctctgcaagagacttccatccagttgccttcttgggactgatgctggtg
acaaccacggccttccctacttcacaagtccggagaggagacttcacagaggataccact
cccaacagacctgtctataccacttcacaagtcggaggcttaattacacatgttctctgg
gaaatcgtggaaatgagaaaagagttgtgcaatggcaattctgattgtatgaacaacgat
gatgcacttgcagaaaacaatctgaaacttccagagatacaaagaaatgatggatgctac
caaactggatataatcaggaaatttgcctattgaaaatttcctctggtcttctggagtac
catagctacctggagtacatgaagaacaacttaaaagataacaagaaagacaaagccaga
gtccttcagagagatacagaaactctaattcatatcttcaaccaagaggtaaaagattta
cataaaatagtccttcctaccccaatttccaatgctctcctaacagataagctggagtca
cagaaggagtggctaaggaccaagaccatccaattcatcttgaaatcacttgaagaattt
ctaaaagtcactttgagatctactcggcaaacctag

DBGET integrated database retrieval system