KEGG   Mus musculus (mouse): 16193Help
Entry
16193             CDS       T01002                                 

Gene name
Il6, Il-6
Definition
interleukin 6
Orthology
K05405  
interleukin 6
Organism
mmu  Mus musculus (mouse)
Pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
TNF signaling pathway
Intestinal immune network for IgA production
Non-alcoholic fatty liver disease (NAFLD)
Prion diseases
Salmonella infection
Pertussis
Legionellosis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Amoebiasis
Tuberculosis
Hepatitis B
Measles
Influenza A
HTLV-I infection
Herpes simplex infection
Pathways in cancer
Transcriptional misregulation in cancer
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Graft-versus-host disease
Hypertrophic cardiomyopathy (HCM)
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:mmu04630]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:mmu04668]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:mmu04066]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mmu04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mmu04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:mmu04060]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:mmu04640]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:mmu04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:mmu04621]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:mmu04623]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:mmu04672]
Human Diseases; Cancers; Pathways in cancer [PATH:mmu05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:mmu05202]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:mmu05323]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:mmu05321]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:mmu05332]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:mmu05020]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:mmu05410]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:mmu04932]
Human Diseases; Infectious diseases; Salmonella infection [PATH:mmu05132]
Human Diseases; Infectious diseases; Pertussis [PATH:mmu05133]
Human Diseases; Infectious diseases; Legionellosis [PATH:mmu05134]
Human Diseases; Infectious diseases; Tuberculosis [PATH:mmu05152]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mmu05166]
Human Diseases; Infectious diseases; Measles [PATH:mmu05162]
Human Diseases; Infectious diseases; Influenza A [PATH:mmu05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:mmu05161]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:mmu05168]
Human Diseases; Infectious diseases; Amoebiasis [PATH:mmu05146]
Human Diseases; Infectious diseases; Malaria [PATH:mmu05144]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:mmu05142]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:mmu05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
5 B1; 5 15.7 cM
AA seq 211 aa AA seqDB search
MKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLW
EIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEY
HSYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLES
QKEWLRTKTIQFILKSLEEFLKVTLRSTRQT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctctctgcaagagacttccatccagttgccttcttgggactgatgctggtg
acaaccacggccttccctacttcacaagtccggagaggagacttcacagaggataccact
cccaacagacctgtctataccacttcacaagtcggaggcttaattacacatgttctctgg
gaaatcgtggaaatgagaaaagagttgtgcaatggcaattctgattgtatgaacaacgat
gatgcacttgcagaaaacaatctgaaacttccagagatacaaagaaatgatggatgctac
caaactggatataatcaggaaatttgcctattgaaaatttcctctggtcttctggagtac
catagctacctggagtacatgaagaacaacttaaaagataacaagaaagacaaagccaga
gtccttcagagagatacagaaactctaattcatatcttcaaccaagaggtaaaagattta
cataaaatagtccttcctaccccaatttccaatgctctcctaacagataagctggagtca
cagaaggagtggctaaggaccaagaccatccaattcatcttgaaatcacttgaagaattt
ctaaaagtcactttgagatctactcggcaaacctag

DBGET integrated database retrieval system