KEGG   Mus musculus (mouse): 16197Help
Entry
16197             CDS       T01002                                 

Gene name
Il7r, CD127, IL-7Ralpha
Definition
interleukin 7 receptor
Orthology
K05072  
interleukin 7 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
Primary immunodeficiency
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:mmu04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mmu04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mmu04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:mmu04060]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:mmu04640]
Human Diseases; Immune diseases; Primary immunodeficiency [PATH:mmu05340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
15 A1; 15 4.16 cM
AA seq 459 aa AA seqDB search
MMALGRAFAIVFCLIQAVSGESGNAQDGDLEDADADDHSFWCHSQLEVDGSQHLLTCAFN
DSDINTANLEFQICGALLRVKCLTLNKLQDIYFIKTSEFLLIGSSNICVKLGQKNLTCKN
MAINTIVKAEAPSDLKVVYRKEANDFLVTFNAPHLKKKYLKKVKHDVAYRPARGESNWTH
VSLFHTRTTIPQRKLRPKAMYEIKVRSIPHNDYFKGFWSEWSPSSTFETPEPKNQGGWDP
VLPSVTILSLFSVFLLVILAHVLWKKRIKPVVWPSLPDHKKTLEQLCKKPKTSLNVSFNP
ESFLDCQIHEVKGVEARDEVESFLPNDLPAQPEELETQGHRAAVHSANRSPETSVSPPET
VRRESPLRCLARNLSTCNAPPLLSSRSPDYRDGDRNRPPVYQDLLPNSGNTNVPVPVPQP
LPFQSGILIPVSQRQPISTSSVLNQEEAYVTMSSFYQNK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgatggctctgggtagagctttcgctatagttttctgcttaattcaagctgtttctgga
gaaagtggaaatgcccaggatggagacctagaagatgcagacgcggacgatcactccttc
tggtgccacagccagttggaagtggatggaagtcaacatttattgacttgtgcttttaat
gactcagacatcaacacagctaatctggaatttcaaatatgtggggctcttttacgagtg
aaatgcctaactcttaacaagctgcaagatatatattttataaagacatcagaattctta
ctgattggtagcagcaatatatgtgtgaagcttggacaaaagaatttaacttgcaaaaat
atggctataaacacaatagttaaagccgaggctccctctgacctgaaagtcgtttatcgc
aaagaagcaaatgattttttggtgacatttaatgcacctcacttgaaaaagaaatattta
aaaaaagtaaagcatgatgtggcctaccgcccagcaaggggtgaaagcaactggacgcat
gtatctttattccacacaagaacaacaatcccacagagaaaactacgaccaaaagcaatg
tatgaaatcaaagtccgatccattccccataacgattacttcaaaggcttctggagcgag
tggagtccaagttctaccttcgaaactccagaacccaagaatcaaggaggatgggatcct
gtcttgccaagtgtcaccattctgagtttgttctctgtgtttttgttggtcatcttagcc
catgtgctatggaaaaaaaggattaaacctgtcgtatggcctagtctccccgatcataag
aaaactctggaacaactatgtaagaagccaaaaacgagtctgaatgtgagtttcaatccc
gaaagtttcctggactgccagattcatgaggtgaaaggcgttgaagccagggacgaggtg
gaaagttttctgcccaatgatcttcctgcacagccagaggagttggagacacagggacac
agagccgctgtacacagtgcaaaccgctcgcctgagacttcagtcagcccaccagaaaca
gttagaagagagtcacccttaagatgcctggctagaaatctgagtacctgcaatgcccct
ccactcctttcctctaggtcccctgactacagagatggtgacagaaataggcctcctgtg
tatcaagacttgctgccaaactctggaaacacaaatgtccctgtccctgtccctcaacca
ttgcctttccagtcgggaatcctgataccagtttctcagagacagcccatctccacttcc
tcagtactgaatcaagaagaagcgtatgtcaccatgtctagtttttaccaaaacaaatga

DBGET integrated database retrieval system