KEGG   Mus musculus (mouse): 16197Help
Entry
16197             CDS       T01002                                 

Gene name
Il7r, CD127, IL-7Ralpha
Definition
(RefSeq) interleukin 7 receptor
  KO
K05072  
interleukin 7 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
Pathways in cancer
Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    16197 (Il7r)
   04068 FoxO signaling pathway
    16197 (Il7r)
   04151 PI3K-Akt signaling pathway
    16197 (Il7r)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16197 (Il7r)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    16197 (Il7r)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    16197 (Il7r)
  Immune diseases
   05340 Primary immunodeficiency
    16197 (Il7r)
Cytokine receptors [BR:mmu04050]
 Class I cytokine receptor (hematopoietin family receptor)
  16197 (Il7r)
CD molecules [BR:mmu04090]
 Proteins
  16197 (Il7r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
15 A1; 15 4.16 cM
AA seq 459 aa AA seqDB search
MMALGRAFAIVFCLIQAVSGESGNAQDGDLEDADADDHSFWCHSQLEVDGSQHLLTCAFN
DSDINTANLEFQICGALLRVKCLTLNKLQDIYFIKTSEFLLIGSSNICVKLGQKNLTCKN
MAINTIVKAEAPSDLKVVYRKEANDFLVTFNAPHLKKKYLKKVKHDVAYRPARGESNWTH
VSLFHTRTTIPQRKLRPKAMYEIKVRSIPHNDYFKGFWSEWSPSSTFETPEPKNQGGWDP
VLPSVTILSLFSVFLLVILAHVLWKKRIKPVVWPSLPDHKKTLEQLCKKPKTSLNVSFNP
ESFLDCQIHEVKGVEARDEVESFLPNDLPAQPEELETQGHRAAVHSANRSPETSVSPPET
VRRESPLRCLARNLSTCNAPPLLSSRSPDYRDGDRNRPPVYQDLLPNSGNTNVPVPVPQP
LPFQSGILIPVSQRQPISTSSVLNQEEAYVTMSSFYQNK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgatggctctgggtagagctttcgctatagttttctgcttaattcaagctgtttctgga
gaaagtggaaatgcccaggatggagacctagaagatgcagacgcggacgatcactccttc
tggtgccacagccagttggaagtggatggaagtcaacatttattgacttgtgcttttaat
gactcagacatcaacacagctaatctggaatttcaaatatgtggggctcttttacgagtg
aaatgcctaactcttaacaagctgcaagatatatattttataaagacatcagaattctta
ctgattggtagcagcaatatatgtgtgaagcttggacaaaagaatttaacttgcaaaaat
atggctataaacacaatagttaaagccgaggctccctctgacctgaaagtcgtttatcgc
aaagaagcaaatgattttttggtgacatttaatgcacctcacttgaaaaagaaatattta
aaaaaagtaaagcatgatgtggcctaccgcccagcaaggggtgaaagcaactggacgcat
gtatctttattccacacaagaacaacaatcccacagagaaaactacgaccaaaagcaatg
tatgaaatcaaagtccgatccattccccataacgattacttcaaaggcttctggagcgag
tggagtccaagttctaccttcgaaactccagaacccaagaatcaaggaggatgggatcct
gtcttgccaagtgtcaccattctgagtttgttctctgtgtttttgttggtcatcttagcc
catgtgctatggaaaaaaaggattaaacctgtcgtatggcctagtctccccgatcataag
aaaactctggaacaactatgtaagaagccaaaaacgagtctgaatgtgagtttcaatccc
gaaagtttcctggactgccagattcatgaggtgaaaggcgttgaagccagggacgaggtg
gaaagttttctgcccaatgatcttcctgcacagccagaggagttggagacacagggacac
agagccgctgtacacagtgcaaaccgctcgcctgagacttcagtcagcccaccagaaaca
gttagaagagagtcacccttaagatgcctggctagaaatctgagtacctgcaatgcccct
ccactcctttcctctaggtcccctgactacagagatggtgacagaaataggcctcctgtg
tatcaagacttgctgccaaactctggaaacacaaatgtccctgtccctgtccctcaacca
ttgcctttccagtcgggaatcctgataccagtttctcagagacagcccatctccacttcc
tcagtactgaatcaagaagaagcgtatgtcaccatgtctagtttttaccaaaacaaatga

DBGET integrated database retrieval system