KEGG   Mus musculus (mouse): 16202Help
Entry
16202             CDS       T01002                                 

Gene name
Ilk, AA511515, ESTM24
Definition
(RefSeq) integrin linked kinase (EC:2.7.11.1)
  KO
K06272  
integrin-linked kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
PPAR signaling pathway
Axon guidance
Focal adhesion
Bacterial invasion of epithelial cells
Endometrial cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    16202 (Ilk)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    16202 (Ilk)
  Development
   04360 Axon guidance
    16202 (Ilk)
 Human Diseases
  Cancers
   05213 Endometrial cancer
    16202 (Ilk)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    16202 (Ilk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     16202 (Ilk)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   16202 (Ilk)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    16202 (Ilk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 E1
AA seq 452 aa AA seqDB search
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLAKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQAPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaacgcggtggcggtgcgcttgtggctg
gacaacacagagaacgacctcaatcagggggatgatcatggcttctcccccttgcactgg
gcctgccgagaaggccgctctgcggtggttgaaatgctgatcatgcgtggagcacggatt
aatgtgatgaatcgtggggatgatacccccctgcacctggcagctagtcatggacaccgt
gacattgtacagaagctgttgcaatacaaggctgacatcaatgcagtgaatgagcacggc
aatgtgccacttcactatgcatgtttctggggccaagaccaggtggcagaggacctggtg
gctaacggggctcttgtgagcatctgtaacaagtatggagagatgcctgtggacaaagcc
aaggcaccccttagagagcttctccgagaacgggcagagaaaatgggccagaatctcaac
cgtattccatacaaggacacattctggaaggggaccactcgcacaaggccccgaaatggg
accctgaacaaacactccggtattgacttcaaacagctcaactttctggcaaagctcaat
gagaatcattctggagagctttggaaaggccgctggcagggcaatgatattgttgtgaag
gtgctgaaggttcgagactggagtacaaggaaaagcagggacttcaatgaggaatgtccc
cggctcaggattttctcacaccctaacgtgctcccagtgctaggtgcttgccaggctccc
ccagccccccacccaaccctcatcacacactggatgccatatggatctctctacaatgtt
ctacatgaaggcaccaatttcgttgtggaccagagccaagctgtaaagtttgctttggac
atggcaagaggcatggcttttcttcacacactagagcctctcataccccggcatgcactc
aatagccgcagtgtaatgatcgatgaagatatgactgcccgaatcagcatggctgatgtt
aagttttctttccagtgccctgggcgcatgtatgcgcctgcctgggtggcccctgaagcc
ctgcagaagaagcctgaagacacaaacagacgctcagcagacatgtggagtttcgcggtg
cttctgtgggaactggtgacacgagaggtgccctttgctgacctctctaatatggagatt
gggatgaaggtggcactggaaggccttcggcctaccatcccaccaggtatttccccccat
gtgtgtaagctcatgaagatttgcatgaatgaagaccctgcaaagcgacccaagtttgac
atgattgtgcctatcttggagaagatgcaggacaagtag

DBGET integrated database retrieval system