KEGG   Mus musculus (mouse): 16336Help
Entry
16336             CDS       T01002                                 

Gene name
Insl3, Rlf, Rlnl
Definition
(RefSeq) insulin-like 3
  KO
K21999  
insulin-like 3
Organism
mmu  Mus musculus (mouse)
Pathway
Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04926 Relaxin signaling pathway
    16336 (Insl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 B3.3; 8 34.43 cM
AA seq 122 aa AA seqDB search
MRAPLLLMLLALGSALRSPQPPEARAKLCGHHLVRTLVRVCGGPRWSPEATQPVETRDRE
LLQWLEQRHLLHALVADVDPALDPQLPLQASQRQRRSAATNAVHRCCLTGCTQQDLLGLC
PH
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgccgctgctactgatgctcctggctctggggtccgcgctgcgctccccgcag
ccccccgaggcacgcgccaagctctgcggccaccacctggtgcgcacgctggtgcgggtg
tgcggcggcccacgctggtcgcccgaggccacgcagcctgtggagacccgggaccgggag
ctgctgcagtggctagagcagagacatctcctgcacgcgctggtggccgacgtggaccca
gcgctagacccgcagcttcctctccaggcttctcagcgccagcgccgcagtgccgccacc
aacgctgtgcaccgctgctgtcttactggctgcacccagcaagacctgttgggtctgtgt
ccccactga

DBGET integrated database retrieval system