KEGG   Mus musculus (mouse): 16362Help
Entry
16362             CDS       T01002                                 

Gene name
Irf1, AU020929, Irf-1
Definition
(RefSeq) interferon regulatory factor 1
  KO
K09444  
interferon regulatory factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
Prolactin signaling pathway
Pertussis
Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    16362 (Irf1)
 Human Diseases
  Infectious diseases
   05133 Pertussis
    16362 (Irf1)
   05160 Hepatitis C
    16362 (Irf1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    16362 (Irf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11 B1.3; 11 32.0 cM
AA seq 329 aa AA seqDB search
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAI
HTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTRNQR
KERKSKSSRDTKSKTKRKLCGDVSPDTFSDGLSSSTLPDDHSSYTTQGYLGQDLDMERDI
TPALSPCVVSSSLSEWHMQMDIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMK
LFEQSEWQPTHIDGKGYLLNEPGTQLSSVYGDFSCKEEPEIDSPRGDIGIGIQHVFTEMK
NMDSIMWMDSLLGNSVRLPPSIQAIPCAP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcactcgaatgcggatgagaccctggctagagatgcagattaattccaaccaa
atcccagggctgatctggatcaataaagaagagatgatcttccagattccatggaagcac
gctgctaagcacggctgggacatcaacaaggatgcctgtctgttccggagctgggccatt
cacacaggccgatacaaagcaggagaaaaagagccagatcccaagacatggaaggcaaac
ttccgttgtgccatgaactccctgccagacatcgaggaagtgaaggatcagagtaggaac
aagggcagctctgctgtgcgggtgtaccggatgctgccacccctcaccaggaaccagagg
aaagagagaaagtccaagtccagccgagacactaagagcaaaaccaagaggaagctgtgt
ggagatgttagcccggacactttctctgatggactcagcagctctaccctacctgatgac
cacagcagttacaccactcagggctacctgggtcaggacttggatatggaaagggacata
actccagcactgtcaccgtgtgtcgtcagcagcagtctctctgagtggcatatgcagatg
gacattataccagatagcaccactgatctgtataacctacaggtgtcacccatgccttcc
acctccgaagccgcaacagacgaggatgaggaagggaagatagccgaagaccttatgaag
ctctttgaacagtctgagtggcagccgacacacatcgatggcaagggatacttgctcaat
gagccagggacccagctctcttctgtctatggagacttcagctgcaaagaggaaccagag
attgacagccctcgaggggacattgggataggcatacaacatgtcttcacggagatgaag
aatatggactccatcatgtggatggacagcctgctgggcaactctgtgaggctgccgccc
tctattcaggccattccttgtgcaccatag

DBGET integrated database retrieval system