KEGG   Mus musculus (mouse): 16367Help
Entry
16367             CDS       T01002                                 

Gene name
Irs1, G972R, IRS-1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04068  FoxO signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04722  Neurotrophin signaling pathway
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04960  Aldosterone-regulated sodium reabsorption
mmu05206  MicroRNAs in cancer
Module
mmu_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    16367 (Irs1)
   04022 cGMP - PKG signaling pathway
    16367 (Irs1)
   04151 PI3K-Akt signaling pathway
    16367 (Irs1)
   04152 AMPK signaling pathway
    16367 (Irs1)
   04150 mTOR signaling pathway
    16367 (Irs1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    16367 (Irs1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    16367 (Irs1)
   04923 Regulation of lipolysis in adipocyte
    16367 (Irs1)
   04920 Adipocytokine signaling pathway
    16367 (Irs1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    16367 (Irs1)
  Nervous system
   04722 Neurotrophin signaling pathway
    16367 (Irs1)
  Aging
   04211 Longevity regulating pathway - mammal
    16367 (Irs1)
   04213 Longevity regulating pathway - multiple species
    16367 (Irs1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    16367 (Irs1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    16367 (Irs1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    16367 (Irs1)
   04931 Insulin resistance
    16367 (Irs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11
Motif
Other DBs
NCBI-GeneID: 16367
NCBI-ProteinID: NP_034700
MGI: 99454
Ensembl: ENSMUSG00000055980
Vega: OTTMUSG00000016464
UniProt: P35569 Q543V3
Position
1 C5; 1 42.0 cM
AA seq 1231 aa AA seqDB search
MASPPDTDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKAH
HDGAGGGCGGSCSGSSGVGEAGEDLSYDTGPGPAFKEVWQVILKPKGLGQTKNLIGIYRL
CLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVV
AQNMHETILEAMRAMSDEFRPRSKSQSSSSCSNPISVPLRRHHLNNPPPSQVGLTRRSRT
ESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHRGSSRL
HPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSPSDGGF
ISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGASTLAAPNGHYIL
SRGGNGHRYIPGANLGTSPALPGDEAAGAADLDNRFRKRTHSAGTSPTISHQKTPSQSSV
ASIEEYTEMMPAAYPPGGGSGGRLPGYRHSAFVPTHSYPEEGLEMHHLERRGGHHRPDTS
NLHTDDGYMPMSPGVAPVPSNRKGNGDYMPMSPKSVSAPQQIINPIRRHPQRVDPNGYMM
MSPSGSCSPDIGGGSSSSSSISAAPSGSSYGKPWTNGVGGHHTHALPHAKPPVESGGGKL
LPCTGDYMNMSPVGDSNTSSPSECYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEPEEGAR
HQHLRLSSSSGRLRYTATAEDSSSSTSSDSLGGGYCGARPESSLTHPHHHVLQPHLPRKV
DTAAQTNSRLARPTRLSLGDPKASTLPRVREQQQQQQSSLHPPEPKSPGEYVNIEFGSGQ
PGYLAGPATSRSSPSVRCPPQLHPAPREETGSEEYMNMDLGPGRRATWQESGGVELGRIG
PAPPGSATVCRPTRSVPNSRGDYMTMQIGCPRQSYVDTSPVAPVSYADMRTGIAAEKASL
PRPTGAAPPPSSTASSSVTPQGATAEQATHSSLLGGPQGPGGMSAFTRVNLSPNHNQSAK
VIRADTQGCRRRHSSETFSAPTRAGNTVPFGAGAAVGGSGGGGGGGSEDVKRHSSASFEN
VWLRPGDLGGVSKESAPVCGAAGGLEKSLNYIDLDLAKERSQDCPSQQQSLPPPPPHQPL
GSNEGNSPRRSSEDLSNYASISFQKQPEDRQ
NT seq 3696 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccctccggataccgatggcttctcagacgtgcgcaaggtgggctacctgcgc
aagcccaagagtatgcataagcgctttttcgtgctgcgggcggccagcgaggccgggggc
ccagcgcgcctggagtattatgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatccccctcgagagctgtttcaacatcaacaagcgggctgactccaagaac
aagcacctggtggctctctacacccgagacgaacactttgccattgccgcggatagcgag
gctgagcaagacagctggtaccaggctcttctgcagctgcataatcgggcaaaggcccac
catgacggggctggaggaggctgcggcggtagctgcagcggcagctctggcgttggagag
gcaggggaggacttgagctatgacacgggtccaggacccgcgttcaaggaggtctggcag
gttatcctgaaacccaagggcctgggtcagacaaagaacctgattggcatctaccgcctc
tgcctgaccagcaagaccatcagctttgtgaagctgaactccgaggcagccgctgtggtg
ctgcagctgatgaatatcagacgctgtggccactcagagaacttcttcttcatcgaggtg
gggcgttccgctgtgacagggcctggcgagttctggatgcaagtggatgactccgtggtg
gcccagaacatgcatgagaccattctagaggcaatgagggccatgagcgatgagtttcgc
cctcgcagcaaaagccagtcttcatccagttgctccaaccccatcagcgttcccctgcgc
aggcaccatctcaacaaccctccacccagccaggtgggactgactcggagatctcgaact
gagagcatcactgccacctcccctgccagtatggtgggtgggaaaccaggttccttccgg
gtgcgtgcctccagcgatggcgaaggcaccatgtcccgtccagcatcagtggatggcagt
cctgtgagccctagcaccaacaggacccacgcccatcggcatcgaggcagctccaggctg
caccccccactcaaccacagccgctccatccccatgccttcttctagatgctcaccttca
gccaccagcccagtgagtctgtcatctagtagtaccagtggccatggctccacttcagac
tgtctcttcccgaggcgctctagtgcttccgtgtccggttcgcctagcgatggcggtttc
atctcttctgatgagtatggttctagtccctgcgatttccgaagttccttccgcagtgtc
accccagattccctggggcacaccccaccagccaggggtgaggaggagctgagcaattat
atctgcatgggtggcaagggagcctccaccttggctgctcccaatggccactacattttg
tctaggggtggcaacggccatcgctacatcccaggtgctaacttggggacaagcccagcg
ctgcctggagatgaagccgcgggtgcagcagatctggataaccggtttcgaaagagaact
cactccgcaggcacatctcctaccatttcccatcagaagaccccctcacagtcttcagtg
gcttctattgaggaatatacagagatgatgcccgctgcctacccaccaggaggtggcagt
ggaggccgactgcccggctaccggcattccgccttcgtgcccacccactcctatcccgaa
gagggtctagagatgcaccacttggaacgtcgtggaggccaccaccgtccagacacctcc
aacctccacactgatgatggctatatgcccatgtctcctggggtggctccagtgcccagc
aaccgcaaaggaaatggggactatatgcccatgagccccaagagtgtatctgccccacag
cagatcattaaccccatcagacgccacccacagagagtggaccccaatggctacatgatg
atgtcacccagtggtagttgctcccctgacattggaggtgggtccagcagcagtagcagc
atcagcgcagccccttctgggagcagctatgggaagccatggacaaatggagtagggggg
caccatactcatgcccttcctcatgccaaacctcctgttgagagtggtggcggtaagctc
ttgccttgcacaggtgactacatgaacatgtccccagtgggagattccaacaccagcagc
ccctcagaatgctactatggcccagaagatccccagcacaagccggtcctctcttactac
tcattgccaaggtcctttaagcacacccagcgccctggagagccagaggagggtgccagg
caccagcatcttcgtctctcttctagctctggacgccttcgctataccgcaactgccgaa
gattcctcctcttctaccagcagcgacagtctgggtgggggttactgtggggctaggcca
gagtcaagcctcacacatccccaccaccatgtcttgcagccccacctgcctcgaaaggta
gacacagctgcacagaccaacagccgcctggctcgacccacaaggctgtccttgggggat
cccaaggcaagcaccttaccccgggttcgagagcagcaacagcagcagcagtcttccctg
caccctcccgagcccaaaagcccaggagaatatgtgaatattgaattcgggagcggccag
cctggctatttagctggccctgcaacttcccgtagctctccttcagttcgatgtccaccc
cagctccacccagctcctagagaagagactggctcggaagagtacatgaacatggacttg
gggccaggccggagggcaacctggcaggagagtggtggagttgagttgggcagaataggc
cctgcacctccggggtctgctacggtttgcaggccaacccgttcggtgccaaatagccgt
ggtgactacatgaccatgcagataggttgtcctcgtcaaagctatgtggatacctcacca
gtggccccagtcagctatgctgacatgcggacaggcattgctgcagagaaggcgagcctg
cctagacccacaggagctgctcctcctccatcctccacagcctcttcttctgttacacct
caaggagccaccgctgagcaagctactcactcttccttgctgggaggccctcagggacct
gggggcatgagtgcattcaccagggtgaacctcagtcccaaccataaccagagtgccaaa
gtgattcgcgcagacactcaagggtgccggaggaggcatagctctgagaccttctcagca
cctactcgggctggcaatacggtgccctttggagcaggggctgcagtagggggcagcggc
ggtggtggtggtggcggcagtgaggatgtaaaacgccacagctctgcatcctttgagaat
gtgtggctgagacctggggatctagggggagtctccaaggagtcggctccagtgtgtggg
gctgctgggggtttggagaagagtcttaactacatagacctggatttggccaaggagcgc
tctcaggactgcccctctcaacagcagtccctaccaccccctccccctcaccagccctta
ggcagcaatgagggcaactccccaagacgctccagtgaggatttaagcaactatgccagc
atcagcttccagaagcagccagaggatcgtcaatag

DBGET integrated database retrieval system