KEGG   Mus musculus (mouse): 16396Help
Entry
16396             CDS       T01002                                 

Gene name
Itch, 6720481N21Rik, 8030492O04Rik, A130065M08, AIP4, C230047C07Rik
Definition
(RefSeq) itchy, E3 ubiquitin protein ligase
  KO
K05632  
atrophin-1 interacting protein 4 [EC:2.3.2.26]
Organism
mmu  Mus musculus (mouse)
Pathway
Ubiquitin mediated proteolysis
Endocytosis
TNF signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    16396 (Itch)
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    16396 (Itch)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    16396 (Itch)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    16396 (Itch)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     16396 (Itch)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    16396 (Itch)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   16396 (Itch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2 H1; 2 76.94 cM
AA seq 864 aa AA seqDB search
MSDSGPQLDSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNT
NSPKWKQPLTVIVTPTSKLCFRVWSHQTLKSDVLLGTAGLDIYETLKSNNMKLEEVVMTL
QLVGDKEPTETMGDLSVCLDGLQVEAEVVTNGETSCSESTTQNDDGCRTRDDTRVSTNGS
EDPEVAASGENKRANGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGSPSTNSDSD
GSSTGSLPPTNTNVNTSTSEGATSGLIIPLTISGGSGPRPLNTVSQAPLPPGWEQRVDQH
GRVYYVDHVEKRTTWDRPEPLPPGWERRVDNMGRIYYVDHFTRTTTWQRPTLESVRNYEQ
WQLQRSQLQGAMQQFNQRFIYGNQDLFATSQNKEFDPLGPLPPGWEKRTDSNGRVYFVNH
NTRITQWEDPRSQGQLNEKPLPEGWEMRFTVDGIPYFVDHNRRATTYIDPRTGKSALDNG
PQIAYVRDFKAKVQYFRFWCQQLAMPQHIKITVTRKTLFEDSFQQIMSFSPQDLRRRLWV
IFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFR
FIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEEC
GLEMYFSVDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFE
GFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRHAIYRHYTRTSKQIMWFWQFVKEI
DNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPP
YKSYEQLKEKLLFAIEETEGFGQE
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacagtggaccacagcttgattccatgggtagtctgaccatgaaatctcaactt
cagatcactgtcatctcagccaaacttaaagaaaataaaaagaattggtttggaccaagt
ccttatgtagaagtcacagtagatggacagtcaaagaagacagaaaaatgcaataataca
aacagtcccaagtggaagcagcccctcacagttattgttacccctacgagtaaattatgt
tttcgtgtgtggagtcaccagaccctgaagtctgatgttttattgggaactgctggatta
gatatttatgaaacattaaagtcaaacaatatgaaacttgaagaagtagttatgactttg
cagcttgtaggtgacaaagagccaacagagacgatgggagatttgtcagtttgtcttgat
gggctgcaagtagaagctgaggttgttactaacggtgaaacgtcatgctccgagagtact
acacagaatgatgatggctgcagaaccagagatgatacaagagtgagcacaaatggatca
gaggaccctgaggttgcagcgtcaggggaaaacaagagggccaatgggaacaattctccg
tccctttcaaatggtggttttaagccttctagacctcctagaccttcgagaccacctcca
cccaccccacgaagaccagcttctgtcaatggctcaccatccacgaattctgacagtgat
ggatctagtacaggctccttgccaccaacaaatacaaatgtaaatacaagtacatctgaa
ggagcaacatctggattaataattcctcttactatatctggaggctcgggccctaggcct
ctgaatactgtaagccaagctcccctaccacctgggtgggagcagagagtagaccagcat
gggcgtgtttactatgtagaccatgttgaaaagcgaacaacatgggatagaccagaacct
ctacctcctggctgggaacggcgtgtggacaatatgggacgtatttattatgttgatcat
ttcacaagaaccacaacatggcagaggccaaccttggaatctgtccggaactatgaacag
tggcagctacagcgtagtcagcttcagggagcaatgcagcagtttaaccagagattcatc
tatgggaatcaagatttgtttgctacatcacaaaacaaagaatttgatccgcttggtccg
ttgccccctggatgggagaagagaactgatagcaacggcagagtgtattttgtcaaccac
aacactcggattactcagtgggaagaccccagaagccaaggtcagttaaatgaaaagccc
ttaccagaaggctgggaaatgagattcacagtggatggaattccatattttgtggaccac
aatagaagagcaactacttatatagatccacgaacgggaaaatcagccttagacaatggg
ccccagatagcctatgtgcgggacttcaaggcaaaagttcagtatttccggttctggtgc
cagcaactggccatgccacagcatataaagatcacagtgacaagaaaaacattgtttgag
gattcctttcagcagatcatgagcttcagcccgcaagacctgagaagacgtttgtgggtg
attttcccaggagaagaaggtttagattatggaggtgtagcaagagaatggttctttctt
ttgtcacatgaagtgttgaacccaatgtattgcctgtttgaatatgcagggaaggataac
tactgcctgcagataaaccccgcttcttacatcaatccagaccacctgaaatactttcgt
tttattggcagatttattgccatggctctgtttcatgggaaattcatagataccggattt
tctttaccattctataaacgtatcctgaataaaccagttggactgaaggatttagaatct
attgatccagaattttataattcgctcatctgggttaaagaaaacaacattgaagaatgt
ggtttggaaatgtacttctcagttgataaagaaattctaggtgaaattaagagtcatgat
ttgaaacccaatggtggcaatattcttgtgacagaagaaaacaaggaggaatacatcagg
atggtagctgagtggaggttgtctcgaggtgttgaagaacagacacaagctttctttgag
ggctttaatgaaattcttcctcagcaatatttgcaatattttgatgcgaaggaattagag
gttcttctgtgtgggatgcaggagattgatttgaatgactggcagagacatgccatctac
cgccactacaccagaacaagcaagcagatcatgtggttttggcagtttgttaaagaaatt
gataatgagaagaggatgagacttctgcagtttgttactggaacctgccgattgccagtg
ggaggatttgctgaccttatggggagtaatggaccacagaagttctgcatcgaaaaagtt
ggcaaagaaaattggttacccagaagccatacttgttttaaccgcctggacctcccacct
tacaagagctatgagcaactgaaggaaaagctgttatttgccattgaagaaactgaagga
tttggacaagagtaa

DBGET integrated database retrieval system