KEGG   Mus musculus (mouse): 16401Help
Entry
16401             CDS       T01002                                 

Gene name
Itga4, CD49D, Itga4B
Definition
(RefSeq) integrin alpha 4
  KO
K06483  
integrin alpha 4
Organism
mmu  Mus musculus (mouse)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Hematopoietic cell lineage
Leukocyte transendothelial migration
Intestinal immune network for IgA production
Regulation of actin cytoskeleton
Leishmaniasis
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    16401 (Itga4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    16401 (Itga4)
   04514 Cell adhesion molecules (CAMs)
    16401 (Itga4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    16401 (Itga4)
  Cellular commiunity
   04510 Focal adhesion
    16401 (Itga4)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    16401 (Itga4)
   04670 Leukocyte transendothelial migration
    16401 (Itga4)
   04672 Intestinal immune network for IgA production
    16401 (Itga4)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    16401 (Itga4)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16401 (Itga4)
   05414 Dilated cardiomyopathy (DCM)
    16401 (Itga4)
  Infectious diseases
   05140 Leishmaniasis
    16401 (Itga4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16401 (Itga4)
  Exosomal proteins of other cancer cells
   16401 (Itga4)
Cell adhesion molecules and their ligands [BR:mmu04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    NRCAM; neuronal cell adhesion molecule [KO:K06756]
     VLA-4 Cell adhesion molecules (CAMs)
      16401 (Itga4)
  Others
   VCAM1; vascular cell adhesion molecule 1 [KO:K06527]
    VLA-4 Cell adhesion molecules (CAMs)
     16401 (Itga4)
    alpha 4 beta7 Cell adhesion molecules (CAMs)
     16401 (Itga4)
   MADCAM1; mucosal vascular addressin cell adhesion molecule 1 [KO:K06779]
     16401 (Itga4)
   LU; Lutheran blood group glycoprotein [KO:K06578]
    VLA-4 Cell adhesion molecules (CAMs)
     16401 (Itga4)
   JAM2; junctional adhesion molecule 2 [KO:K06735]
     16401 (Itga4)
Cellular antigens [BR:mmu04090]
 Proteins
  16401 (Itga4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 C3; 2 47.38 cM
AA seq 1032 aa AA seqDB search
MAAEARCRPRSRGIALREAVMLLLYFGVPTGHSYNLDPENALLYQGPSGTLFGYSVVLHS
HGSKRWLIVGAPTASWLSNASVVNPGAIYRCGIRKNPNQTCEQLQLGSPSGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYMKSDNKLPTGICYVMPSDLRTELSKRM
APCYKDYTRKFGENFASCQAGISSFYTQDLIVMGAPGSSYWTGTVFVYNITTNQYKAFVD
RQNQVKFGSYLGYSVGAGHFRSPHTTEVVGGAPQHEQIGKAYIFSIDENELNIVYEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGMGAVMVEMERVLVG
SDKYAARFGESIANLGDIDNDGFEDIAIGAPQEDDLRGAVYIYNGRVDGISSTYSQRIEG
QQISKSLRMFGQSISGQIDADNNGYVDVAVGAFQSDSAVLLRTRPVVIVEASLSHPESVN
RTKFDCTENGLPSVCMHLTLCFSYKGKEVPGYIVLFYNVSLDVHRKAESPSRFYFFSNGT
SDVITGSIRVSSSGEKCRTHQAFMRKDVRDILTPIHVEATYHLGHHVITKRNTEEFPPLQ
PILQQKKEKDVIRKMINFARFCAYENCSADLQVSAKVGFLKPYENKTYLAVGSMKTIMLN
VSLFNAGDDAYETTLNVQLPTGLYFIKILDLEEKQINCEVTESSGIVKLACSLGYIYVDR
LSRIDISFLLDVSSLSRAHEDLSISVHASCENEGELDQVRDNRVTLTIPLRYEVMLTVHG
LVNPTSFVYGSSEENEPETCMAEKLNLTFHVINTGISMAPNVSVKIMVPNSFLPQDDKLF
NVLDVQTTTGQCHFKHYGRECTFAQQKGIAGTLTDIVKFLSKTDKRLLYCMKADQHCLDF
LCNFGKMESGKEASVHIQLEGRPSILEMDETSSLKFEIKATAFPEPHPKVIELNKDENVA
HVFLEGLHHQRPKRHFTIIIITISLLLGLIVLLLISCVMWKAGFFKRQYKSILQEENRRD
SWSYVNSKSNDD
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggaagcgaggtgcagaccgaggtcccgagggatcgccctccgggaagcggtg
atgctgttgttgtacttcggggtgccaaccgggcactcctacaacctggacccggagaat
gcactgctgtaccagggcccctccggcacgctgtttggctactcggtggtgctgcacagc
cacgggtcgaagcgctggctcatcgtgggggctcccactgccagctggctctctaatgcc
tcagtggtcaatcctggggcgatttacagatgcgggatcagaaagaatccaaaccagacc
tgcgaacagctccagctgggtagccccagtggagagccttgtgggaagacatgcctggag
gagagggataaccagtggctgggggtcaccctttccagacagcctggagaaaatggctct
atcgtgacttgtgggcacaggtggaaaaatattttttacatgaagagcgataacaaactc
cccactggcatttgctacgtcatgccttctgatttgcggacagaactgagtaaaaggatg
gccccgtgttacaaagattatacgagaaaatttggagaaaattttgcatcatgtcaagct
ggaatatctagtttttacacacaggatttaattgtgatgggggccccgggatcatcgtac
tggactggcaccgtctttgtctacaatataactacaaaccaatacaaagcatttgtagac
agacagaaccaagtaaaatttggaagctacttaggctactcagttggagctggacatttt
cgaagtccacatactaccgaagtcgtgggaggagcccctcaacacgaacagataggaaaa
gcatatatatttagcattgatgaaaacgaactgaacatcgtatatgaaatgaaaggtaaa
aagcttggctcatactttggagcttctgtctgcgctgtggacctcaatgcagatggcttc
tcagatctccttgttggagctcccatgcagagcaccatcagggaggaaggaagagtattc
gtgtacatcaactctggcatgggagctgtgatggttgaaatggaaagggtccttgtcgga
agtgacaaatatgctgcaagatttggggagtctatagcgaatcttggcgacattgacaat
gacggctttgaagatattgctattggtgcaccacaagaagacgacttgagaggtgctgtc
tacatttacaatggccgagtcgatggaatctcctccacctactcacagagaattgaagga
cagcaaatcagcaaatcattaaggatgtttggacaatctatctcaggacaaattgatgca
gacaacaatggatatgttgatgtagccgttggtgcatttcaatctgattctgcagtgttg
ctaaggacaaggcctgtagtgattgttgaagcatctttaagccatcctgagtctgtaaat
aggacaaagtttgactgtactgaaaatggacttccatctgtgtgcatgcatcttacactg
tgtttctcatataaaggcaaagaggtcccaggctacatcgttttgttttacaatgtgagc
ttggatgtgcacaggaaggcagagtctccgtcaagattttatttcttctctaatgggact
tctgacgtgattacaggaagcatacgagtttcaagcagtggagagaaatgtaggacacac
caggcattcatgcggaaagacgtgcgagacatccttacccccattcatgtagaggccaca
taccaccttgggcatcatgtgatcaccaaacgaaacactgaggaatttccaccactccag
ccgatccttcagcagaagaaagaaaaagacgttattagaaaaatgataaactttgcaagg
ttttgtgcctatgaaaattgctctgctgatctccaagtttctgcaaaagttggatttttg
aagccatatgaaaataaaacctatcttgctgttgggagcatgaagaccataatgctaaac
gtgtccttgttcaacgctggcgatgatgcttacgaaaccactctgaatgtccaactcccc
acaggcctttatttcattaagatcttagacctggaagagaaacaaataaactgcgaagtg
actgagagctcaggcatagtgaagcttgcctgcagcctaggttacatatatgtggatcgc
ctctcaaggatagacattagctttctcctggatgtgagctcactcagcagggcacatgag
gacctcagcatcagtgtgcatgcctcctgtgaaaacgagggcgaattggaccaagtgagg
gacaacagagtgaccttaacgatacctctaaggtatgaggttatgctgactgttcatggg
cttgtgaacccaacttcatttgtgtatggatctagcgaagaaaacgagccagaaacatgc
atggccgagaagctgaacctcactttccatgttataaacactgggattagcatggctcca
aatgttagtgtgaaaataatggtaccaaattcttttctccctcaagatgataagttgttc
aacgttttggatgtccagacaactacagggcaatgccattttaaacactatggaagagag
tgtacatttgcacagcaaaaaggcatagcggggacgttgaccgatatagtcaaattccta
tcaaagactgataagagactcctgtattgcatgaaagctgatcaacactgtttagatttc
ttatgcaatttcggaaaaatggaaagtgggaaggaagccagcgttcatattcagctggag
ggcaggccatccatcttggaaatggatgagacctcatcactcaagtttgaaataaaagca
acagcttttccagagccacacccaaaagttattgaactaaataaagatgagaacgtggcc
catgttttcttggaagggctccatcatcaaagacccaaacgacatttcaccatcattatt
attaccatcagcttgctacttggacttattgtacttttattaatttcatgtgttatgtgg
aaggctggattctttaaaagacagtacaaatctatcctacaagaagaaaacaggagagac
agctggagttatgtcaacagcaaaagcaatgatgactga

DBGET integrated database retrieval system