KEGG   Mus musculus (mouse): 16402Help
Entry
16402             CDS       T01002                                 

Gene name
Itga5, Cd49e, Fnra, VLA5
Definition
(RefSeq) integrin alpha 5 (fibronectin receptor alpha)
  KO
K06484  
integrin alpha 5
Organism
mmu  Mus musculus (mouse)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Hematopoietic cell lineage
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pertussis
Proteoglycans in cancer
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    16402 (Itga5)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    16402 (Itga5)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    16402 (Itga5)
  Cell motility
   04810 Regulation of actin cytoskeleton
    16402 (Itga5)
  Cellular community - eukaryotes
   04510 Focal adhesion
    16402 (Itga5)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    16402 (Itga5)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    16402 (Itga5)
   05205 Proteoglycans in cancer
    16402 (Itga5)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    16402 (Itga5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16402 (Itga5)
   05414 Dilated cardiomyopathy (DCM)
    16402 (Itga5)
  Infectious diseases
   05133 Pertussis
    16402 (Itga5)
   05100 Bacterial invasion of epithelial cells
    16402 (Itga5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16402 (Itga5)
Cell adhesion molecules and their ligands [BR:mmu04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     VLA-5 Cell adhesion molecules (CAMs)
      16402 (Itga5)
 5. Cadherin Family
  Clustered protocadherin
   PCDHA; protocadherin alpha [KO:K16493]
    VLA-5 Cell adhesion molecules (CAMs)
     16402 (Itga5)
 7. Others
  TNFSF5, CD40L; tumor necrosis factor (ligand) superfamily, member 5 [KO:K03161]
   VLA-5 Cell adhesion molecules (CAMs)
    16402 (Itga5)
  SDC1; syndecan 1 [KO:K06257]
    16402 (Itga5)
  SDC4; syndecan 4 [KO:K16338]
    16402 (Itga5)
Cellular antigens [BR:mmu04090]
 Proteins
  16402 (Itga5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 F3; 15 58.9 cM
AA seq 1053 aa AA seqDB search
MGSWTPRSPRSPLHAVLLRWGPRRLPPLLPLLLLLWPPPLQVGGFNLDAEAPAVLSGPPG
SLFGFSVEFYRPGRDGVSVLVGAPKANTSQPGVLQGGAVYVCPWGTSPIQCTTIQFDSKG
SRILESSLYSAKGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKDPQNDPVGTCY
LSTENFTRILEYAPCRSDFGSAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSAT
QEQISESYYPEYLINPVQGQLQTRQASSVYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGN
LTYGYVTVLNGSDIHSLYNVSGEQMASYFGYAVAATDTNGDGLDDLLVGAPLLMERTADG
RPQEVGRVYIYLQRPAGIDPTPTLTLTGQDEFSRFGSSLTPLGDLDQDGYNDVAIGAPFG
GEAQQGVVFIFPGGPGGLSTKPSQVLQPLWAAGRTPDFFGSALRGGRDLDGNGYPDLIVG
SFGVDKALVYRGRPIISASASLTIFPSMFNPEERSCSLEGNPVSCINLSFCLNASGKHVP
NSIGFEVELQLDWQKQKGGVRRALFLTSKQATLTQTLLIQNGAREDCREMKIYLRNESEF
RDKLSPIHIALNFSLDPKAPMDSHGLRPVLHYQSKSRIEDKAQILLDCGEDNICVPDLQL
DVYGEKKHVYLGDKNALNLTFHAQNLGEGGAYEAELRVTAPLEAEYSGLVRHPGNFSSLS
CDYFAVNQSRQLVCDLGNPMKAGTSLWGGLRFTVPHLQDTKKTIQFDFQILSKNLNNSQS
NVVSFPLSVEAQAQVSLNGVSKPEAVIFPVSDWNPQDQPQKEEDLGPAVHHVYELINQGP
SSISQGVLELSCPQALEGQQLLYVTKVTGLSNCTSNYTPNSQGLELDPETSPHHLQKREA
PGRSSTASGTQVLKCPEAKCFRLRCEFGPLHRQESRSLQLHFRVWAKTFLQREYQPFSLQ
CEAVYEALKMPYQILPRQLPQKKLQVATAVQWTKAEGSNGVPLWIIILAILFGLLLLGLL
IYVLYKLGFFKRSLPYGTAMEKAQLKPPATSDA
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atggggagctggacgccacggtcgcctcgatctcctctccacgcggtgctgctgcgctgg
gggccccgacgcctaccgccgctgctgcctctgctgctgctactgtggccgccaccactc
caggttgggggcttcaacctagacgcggaggccccggcggtgctctccgggccccccggc
tccctttttggcttctccgtggagttttaccggccgggaagggacggagtcagtgtgctg
gttggggcacccaaggctaacactagccagccaggtgtactgcaaggtggtgctgtctat
gtgtgtccctggggcaccagtcctatccagtgcaccaccattcaatttgacagcaaaggc
tcccggattctggagtcctcactgtacagtgccaagggagaggagcctgtggagtacaag
tccttgcagtggttcggagcaacagttcgggcccatggctcctccatcttggcatgtgct
ccactgtatagctggcgcacagaaaaggacccacagaatgacccagtgggcacctgctac
ctctccacagaaaacttcacccggattctggagtacgcaccttgccgctcagattttggc
agtgcagcagggcagggctactgccaagggggcttcagtgctgagttcaccaagactggc
cgtgtggtcctgggtggacctggaagctacttctggcaaggccagatcctgtccgccact
caagagcagatctcggagtcctattacccagagtatctcatcaaccctgttcaggggcag
ctgcagacccgccaggccagctccgtctatgatgacagctacttgggatactctgtggct
gtgggtgaattcagtggtgatgacacagaagactttgttgctggcgtgcccaaggggaac
ctcacctatggctatgtcaccgtccttaatggctcagacatccactccctctacaacgtc
tcaggagaacagatggcctcctacttcggctatgctgtggctgccactgataccaatgga
gatgggctagatgacctactggtaggggcacccctgctcatggagcggacagctgatggg
agacctcaggaggtgggcagggtctacatctatctgcagcgcccagcgggcatagatccc
acacccaccctcaccctcactgggcaagatgagttcagccgattcggcagctccttgaca
cccttgggggacctggaccaagacggctacaatgatgtcgccattggggctccatttggt
ggggaggcccagcagggagtcgtatttatattcccgggaggcccaggaggactgagcact
aaaccttcccaggttttgcagcctctttgggcagctggccgtaccccagacttctttggc
tctgcccttcgaggaggacgagatctggatggcaatggataccctgatctaatcgttgga
tcctttggtgtggacaaggctctggtgtacagagggcggcccatcatatctgccagcgca
tctctcaccatcttcccctccatgttcaacccagaggagcgcagttgcagcctggaaggg
aaccctgtgtcctgcatcaaccttagcttctgcctcaatgcctctggaaaacatgtcccc
aactctataggcttcgaggtggaactccaactggactggcagaagcaaaagggaggggtc
cggcgggcactgttcctgacttccaagcaggccacccttacccagaccctgcttatccag
aatggggctcgggaggactgcagggagatgaagatctacctcaggaatgaatcagaattc
agagacaaactctccccaattcacattgccctcaacttctccttggaccccaaagctccc
atggacagccatggcctccggccagttctacactaccaaagcaaaagcaggatagaggac
aaggcccagatcttgctggactgtggtgaagacaatatctgtgtgcctgacctgcagctg
gatgtgtatggggagaagaaacatgtgtacctgggtgacaagaacgcactgaacctgaca
ttccatgcccaaaatctgggtgagggcggtgcctatgaagccgagcttcgggtcacagcc
cctctagaggccgagtactcaggacttgtcagacacccagggaacttctccagcctgagc
tgtgactactttgctgtgaaccagagccgccagctggtgtgtgacctgggcaaccccatg
aaggcaggcaccagtctctggggtggccttcggttcactgttcctcatcttcaagacaca
aagaaaaccatccagtttgactttcagatcctcagcaagaacctgaacaactcacaaagc
aacgtggtctccttcccactctcggtggaggctcaagcccaggtctcccttaatggtgtc
tccaagcctgaagctgtgattttcccagtcagcgactggaatcctcaagaccagcctcag
aaggaggaagacttgggcccagctgtccaccatgtctacgagctcatcaaccaggggccc
agctccatcagccagggtgtgctggagctcagctgtccacaggctctggaaggccaacag
ctcctctatgtgaccaaggtgacaggactcagcaactgcacctccaactacacccccaac
tcacagggcctggagttggatccagagacctctccacaccacctgcagaaacgagaggct
ccagggaggagttctactgcctcaggaacacaagttctgaaatgccctgaagccaagtgt
ttcaggctgcgctgtgagtttgggccactgcaccgccaagagagccgtagtctgcagctg
catttccgagtctgggccaagaccttcttgcagcgggaataccagccatttagccttcag
tgtgaggctgtatatgaagctctgaagatgccctaccagatcctgcctcggcagcttccc
caaaagaaacttcaggtggccacagccgtgcagtggaccaaggcagaaggcagcaatggt
gtcccgttgtggatcatcatcctagccattctttttggcctcctgctcctaggtctgctc
atctacgtcctctacaagctcggcttcttcaaacgttccctcccctacggcacagccatg
gaaaaagctcagctcaagcctccagccacctcagatgcctga

DBGET integrated database retrieval system