KEGG   Mus musculus (mouse): 16402Help
Entry
16402             CDS       T01002                                 

Gene name
Itga5, Cd49e, Fnra, VLA5
Definition
(RefSeq) integrin alpha 5 (fibronectin receptor alpha)
  KO
K06484  integrin alpha 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05100  Bacterial invasion of epithelial cells
mmu05133  Pertussis
mmu05165  Human papillomavirus infection
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    16402 (Itga5)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    16402 (Itga5)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    16402 (Itga5)
  Cellular community - eukaryotes
   04510 Focal adhesion
    16402 (Itga5)
  Cell motility
   04810 Regulation of actin cytoskeleton
    16402 (Itga5)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    16402 (Itga5)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    16402 (Itga5)
   05205 Proteoglycans in cancer
    16402 (Itga5)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    16402 (Itga5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16402 (Itga5)
   05414 Dilated cardiomyopathy (DCM)
    16402 (Itga5)
  Infectious diseases
   05133 Pertussis
    16402 (Itga5)
   05100 Bacterial invasion of epithelial cells
    16402 (Itga5)
   05165 Human papillomavirus infection
    16402 (Itga5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16402 (Itga5)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16402 (Itga5)
CD molecules [BR:mmu04090]
 Proteins
  16402 (Itga5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 16402
NCBI-ProteinID: NP_034707
MGI: 96604
Ensembl: ENSMUSG00000000555
Vega: OTTMUSG00000062577
UniProt: P11688 Q80YP5
Position
15 F3; 15 58.9 cM
AA seq 1053 aa AA seqDB search
MGSWTPRSPRSPLHAVLLRWGPRRLPPLLPLLLLLWPPPLQVGGFNLDAEAPAVLSGPPG
SLFGFSVEFYRPGRDGVSVLVGAPKANTSQPGVLQGGAVYVCPWGTSPIQCTTIQFDSKG
SRILESSLYSAKGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKDPQNDPVGTCY
LSTENFTRILEYAPCRSDFGSAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSAT
QEQISESYYPEYLINPVQGQLQTRQASSVYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGN
LTYGYVTVLNGSDIHSLYNVSGEQMASYFGYAVAATDTNGDGLDDLLVGAPLLMERTADG
RPQEVGRVYIYLQRPAGIDPTPTLTLTGQDEFSRFGSSLTPLGDLDQDGYNDVAIGAPFG
GEAQQGVVFIFPGGPGGLSTKPSQVLQPLWAAGRTPDFFGSALRGGRDLDGNGYPDLIVG
SFGVDKALVYRGRPIISASASLTIFPSMFNPEERSCSLEGNPVSCINLSFCLNASGKHVP
NSIGFEVELQLDWQKQKGGVRRALFLTSKQATLTQTLLIQNGAREDCREMKIYLRNESEF
RDKLSPIHIALNFSLDPKAPMDSHGLRPVLHYQSKSRIEDKAQILLDCGEDNICVPDLQL
DVYGEKKHVYLGDKNALNLTFHAQNLGEGGAYEAELRVTAPLEAEYSGLVRHPGNFSSLS
CDYFAVNQSRQLVCDLGNPMKAGTSLWGGLRFTVPHLQDTKKTIQFDFQILSKNLNNSQS
NVVSFPLSVEAQAQVSLNGVSKPEAVIFPVSDWNPQDQPQKEEDLGPAVHHVYELINQGP
SSISQGVLELSCPQALEGQQLLYVTKVTGLSNCTSNYTPNSQGLELDPETSPHHLQKREA
PGRSSTASGTQVLKCPEAKCFRLRCEFGPLHRQESRSLQLHFRVWAKTFLQREYQPFSLQ
CEAVYEALKMPYQILPRQLPQKKLQVATAVQWTKAEGSNGVPLWIIILAILFGLLLLGLL
IYVLYKLGFFKRSLPYGTAMEKAQLKPPATSDA
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atggggagctggacgccacggtcgcctcgatctcctctccacgcggtgctgctgcgctgg
gggccccgacgcctaccgccgctgctgcctctgctgctgctactgtggccgccaccactc
caggttgggggcttcaacctagacgcggaggccccggcggtgctctccgggccccccggc
tccctttttggcttctccgtggagttttaccggccgggaagggacggagtcagtgtgctg
gttggggcacccaaggctaacactagccagccaggtgtactgcaaggtggtgctgtctat
gtgtgtccctggggcaccagtcctatccagtgcaccaccattcaatttgacagcaaaggc
tcccggattctggagtcctcactgtacagtgccaagggagaggagcctgtggagtacaag
tccttgcagtggttcggagcaacagttcgggcccatggctcctccatcttggcatgtgct
ccactgtatagctggcgcacagaaaaggacccacagaatgacccagtgggcacctgctac
ctctccacagaaaacttcacccggattctggagtacgcaccttgccgctcagattttggc
agtgcagcagggcagggctactgccaagggggcttcagtgctgagttcaccaagactggc
cgtgtggtcctgggtggacctggaagctacttctggcaaggccagatcctgtccgccact
caagagcagatctcggagtcctattacccagagtatctcatcaaccctgttcaggggcag
ctgcagacccgccaggccagctccgtctatgatgacagctacttgggatactctgtggct
gtgggtgaattcagtggtgatgacacagaagactttgttgctggcgtgcccaaggggaac
ctcacctatggctatgtcaccgtccttaatggctcagacatccactccctctacaacgtc
tcaggagaacagatggcctcctacttcggctatgctgtggctgccactgataccaatgga
gatgggctagatgacctactggtaggggcacccctgctcatggagcggacagctgatggg
agacctcaggaggtgggcagggtctacatctatctgcagcgcccagcgggcatagatccc
acacccaccctcaccctcactgggcaagatgagttcagccgattcggcagctccttgaca
cccttgggggacctggaccaagacggctacaatgatgtcgccattggggctccatttggt
ggggaggcccagcagggagtcgtatttatattcccgggaggcccaggaggactgagcact
aaaccttcccaggttttgcagcctctttgggcagctggccgtaccccagacttctttggc
tctgcccttcgaggaggacgagatctggatggcaatggataccctgatctaatcgttgga
tcctttggtgtggacaaggctctggtgtacagagggcggcccatcatatctgccagcgca
tctctcaccatcttcccctccatgttcaacccagaggagcgcagttgcagcctggaaggg
aaccctgtgtcctgcatcaaccttagcttctgcctcaatgcctctggaaaacatgtcccc
aactctataggcttcgaggtggaactccaactggactggcagaagcaaaagggaggggtc
cggcgggcactgttcctgacttccaagcaggccacccttacccagaccctgcttatccag
aatggggctcgggaggactgcagggagatgaagatctacctcaggaatgaatcagaattc
agagacaaactctccccaattcacattgccctcaacttctccttggaccccaaagctccc
atggacagccatggcctccggccagttctacactaccaaagcaaaagcaggatagaggac
aaggcccagatcttgctggactgtggtgaagacaatatctgtgtgcctgacctgcagctg
gatgtgtatggggagaagaaacatgtgtacctgggtgacaagaacgcactgaacctgaca
ttccatgcccaaaatctgggtgagggcggtgcctatgaagccgagcttcgggtcacagcc
cctctagaggccgagtactcaggacttgtcagacacccagggaacttctccagcctgagc
tgtgactactttgctgtgaaccagagccgccagctggtgtgtgacctgggcaaccccatg
aaggcaggcaccagtctctggggtggccttcggttcactgttcctcatcttcaagacaca
aagaaaaccatccagtttgactttcagatcctcagcaagaacctgaacaactcacaaagc
aacgtggtctccttcccactctcggtggaggctcaagcccaggtctcccttaatggtgtc
tccaagcctgaagctgtgattttcccagtcagcgactggaatcctcaagaccagcctcag
aaggaggaagacttgggcccagctgtccaccatgtctacgagctcatcaaccaggggccc
agctccatcagccagggtgtgctggagctcagctgtccacaggctctggaaggccaacag
ctcctctatgtgaccaaggtgacaggactcagcaactgcacctccaactacacccccaac
tcacagggcctggagttggatccagagacctctccacaccacctgcagaaacgagaggct
ccagggaggagttctactgcctcaggaacacaagttctgaaatgccctgaagccaagtgt
ttcaggctgcgctgtgagtttgggccactgcaccgccaagagagccgtagtctgcagctg
catttccgagtctgggccaagaccttcttgcagcgggaataccagccatttagccttcag
tgtgaggctgtatatgaagctctgaagatgccctaccagatcctgcctcggcagcttccc
caaaagaaacttcaggtggccacagccgtgcagtggaccaaggcagaaggcagcaatggt
gtcccgttgtggatcatcatcctagccattctttttggcctcctgctcctaggtctgctc
atctacgtcctctacaagctcggcttcttcaaacgttccctcccctacggcacagccatg
gaaaaagctcagctcaagcctccagccacctcagatgcctga

DBGET integrated database retrieval system