KEGG   Mus musculus (mouse): 16409Help
Entry
16409             CDS       T01002                                 

Gene name
Itgam, CD11b/CD18, CR3, CR3A, Cd11b, F730045J24Rik, Ly-40, MAC1, Mac-1, Mac-1a
Definition
(RefSeq) integrin alpha M
  KO
K06461  
integrin alpha M
Organism
mmu  Mus musculus (mouse)
Pathway
Rap1 signaling pathway
Phagosome
Cell adhesion molecules (CAMs)
Complement and coagulation cascades
Hematopoietic cell lineage
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Pertussis
Legionellosis
Leishmaniasis
Amoebiasis
Staphylococcus aureus infection
Tuberculosis
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    16409 (Itgam)
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    16409 (Itgam)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    16409 (Itgam)
  Cell motility
   04810 Regulation of actin cytoskeleton
    16409 (Itgam)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    16409 (Itgam)
   04610 Complement and coagulation cascades
    16409 (Itgam)
   04670 Leukocyte transendothelial migration
    16409 (Itgam)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    16409 (Itgam)
  Infectious diseases
   05133 Pertussis
    16409 (Itgam)
   05134 Legionellosis
    16409 (Itgam)
   05150 Staphylococcus aureus infection
    16409 (Itgam)
   05152 Tuberculosis
    16409 (Itgam)
   05146 Amoebiasis
    16409 (Itgam)
   05140 Leishmaniasis
    16409 (Itgam)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16409 (Itgam)
Cell adhesion molecules and their ligands [BR:mmu04516]
 1. Immunoglobulin Superfamily
  Immune system
   ICAM family
    ICAM1; intercellular adhesion molecule 1 [KO:K06490]
     CR3, Mac-1 Cell adhesion molecules (CAMs)
      16409 (Itgam)
    ICAM2; intercellular adhesion molecule 2 [KO:K06523]
      16409 (Itgam)
  Neural system
   N/0 subfamily
    THY1, CD90; Thy-1 cell surface antigen [KO:K06514]
      16409 (Itgam)
  Others
   VCAM1; vascular cell adhesion molecule 1 [KO:K06527]
    CR3, Mac-1 Cell adhesion molecules (CAMs)
     16409 (Itgam)
   ICAM4; intercellular adhesion molecule 4 [KO:K06581]
     16409 (Itgam)
   JAM3; junctional adhesional molecule 3 [KO:K06785]
     16409 (Itgam)
 3. Selectin Family
  SELE; selectin, endothelial cell [KO:K06494]
   CR3, Mac-1 Cell adhesion molecules (CAMs)
    16409 (Itgam)
 7. Others
  TNFSF5, CD40L; tumor necrosis factor (ligand) superfamily, member 5 [KO:K03161]
    16409 (Itgam)
  CD209; CD209 antigen [KO:K06563]
    16409 (Itgam)
Cellular antigens [BR:mmu04090]
 Proteins
  16409 (Itgam)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Adhesion molecules of cell surface (General comment) Cell attachment, inflammation, transition
   16409 (Itgam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
7; 7 F4
AA seq 1154 aa AA seqDB search
MTLKALLVTALALCHGFNLDTEHPMTFQENAKGFGQSVVQLGGTSVVVAAPQEAKAVNQT
GALYQCDYSTSRCHPIPLQVPPEAVNMSLGLSLAVSTVPQQLLACGPTVHQNCKENTYVN
GLCYLFGSNLLRPPQQFPEALRECPQQESDIVFLIDGSGSINNIDFQKMKEFVSTVMEQF
KKSKTLFSLMQYSDEFRIHFTFNDFKRNPSPRSHVSPIKQLNGRTKTASGIRKVVRELFH
KTNGARENAAKILVVITDGEKFGDPLDYKDVIPEADRAGVIRYVIGVGNAFNKPQSRREL
DTIASKPAGEHVFQVDNFEALNTIQNQLQEKIFAIEGTQTGSTSSFEHEMSQEGFSASIT
SNGPLLGSVGSFDWAGGAFLYTSKDKVTFINTTRVDSDMNDAYLGYASAVILRNRVQSLV
LGAPRYQHIGLVVMFRENFGTWEPHTSIKGSQIGSYFGASLCSVDMDADGNTNLILIGAP
HYYEKTRGGQVSVCPLPRGQRARWQCEALLHGDQGHPWGRFGAALTVLGDVNGDKLTDVA
IGAPGEQENQGAVYIFYGASIASLSASHSQRIIGAHFSPGLQYFGQSLSGGKDLTMDGLM
DLAVGAQGHLLLLRAQPVLRLEATMEFSPKKVARSVFACQEQVLKNKDAGEVRVCLRVRK
NTKDRLREGDIQSTVTYDLALDPGRSRIRAFFDETKNNTRRRTQVFGLMQKCETLKLILP
DCVDDSVSPIILRLNYTLVGEPLRSFGNLRPVLAMDAQRFFTAMFPFEKNCGNDSICQDD
LSITMSAMGLDTLVVGGPQDFNMSVTLRNDGEDSYGTQVTVYYPSGLSYRKDSASQNPLT
KKPWFVKPAESSSSSEGHGALKSTTWNINHPIFPANSEVTFNVTFDVDSHASFGNKLLLK
AIVASENNMSRTHKTKFQLELPVKYAIYMIVTSDESSIRYLNFTASEMTSKVIQHQYQFN
NLGQRSLPVSVVFWIPVQINNVTVWDHPQVIFSQNLSSACHTEQKSPPHSNFRDQLERTP
VLNCSVAVCKRIQCDLPSFNTQEIFNVTLKGNLSFDWYIKTSHGHLLLVSSTEILFNDSA
FALLPGQESYVRSKTETKVEPYEVHNPVPLIVGSSIGGLVLLALITAGLYKLGFFKRQYK
DMMNEAAPQDAPPQ
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atgactcttaaagctcttctggtcacagccctagccttgtgtcatggcttcaatctggac
actgaacatcccatgaccttccaagagaatgcaaaaggctttggacagagtgtggtccag
cttggcggaaccagtgtggttgttgcagccccccaggaggcaaaggctgttaaccagaca
ggtgccctctaccagtgtgactacagcacaagccggtgtcaccccatccccctgcaagta
cctccagaggctgtgaatatgtccttgggcctgtccctggctgtttctactgtcccccag
cagctgctggcctgtggccccacggtgcaccaaaactgcaaggagaatacttatgtgaat
ggattgtgctatttgttcggctccaacctgctgaggccgccccagcagttcccagaggct
ctcagagaatgtcctcagcaggagagtgacattgtcttcttgattgatggctccggtagc
atcaacaacattgactttcagaagatgaaggagtttgtctcaactgtgatggagcagttc
aaaaagtctaaaaccttgttctctttgatgcagtactcggacgagttccggattcacttc
accttcaatgacttcaagagaaaccctagcccaagatcacatgtgagccccataaagcag
ctgaatgggaggacaaaaactgcctcagggatccggaaagtagtgagagaactgtttcac
aaaaccaatggggcccgggagaatgctgcgaagatcctagttgtcatcacagatggagaa
aaattcggtgatcccttggattataaggatgtcatccccgaggcagacagagcaggggtc
attcgctacgtaattggggtgggaaatgccttcaacaaaccacagtcccgcagagagctc
gacaccatcgcatctaagccagctggtgaacacgtgttccaagtggacaactttgaagcc
ctgaataccattcagaaccagcttcaggaaaagatctttgcaattgagggcacgcagaca
ggaagtaccagctcctttgagcatgagatgtctcaagaaggcttcagtgcttccattacc
tctaatggtcccttgctgggctctgtggggagctttgactgggcaggtggagccttcctg
tatacatcgaaggataaagtcaccttcatcaacacaaccagagtggattcagacatgaat
gatgcttacctgggttatgcttctgcagtcatcttgaggaaccgtgtccaaagcttggtt
ttaggagcacctcggtatcagcatattggcttggtggtgatgttcagggagaatttcggt
acctgggagccccacactagcatcaagggcagccagattggctcttattttggggcctcc
ctttgctctgtggacatggacgctgatggcaataccaacttgatcctcattggggcccct
cattactatgagaagacccgaggaggccaggtgtcagtgtgtcccttgcctcgagggcag
agggcacggtggcagtgtgaagctcttctccacggtgatcagggtcatccctggggtcgc
tttggggcagccctgacagtgctgggagacgtgaatggggacaaactgacagatgtggcc
attggggccccaggagagcaggagaatcagggcgctgtctacattttttatggagcatca
atagccagcctcagtgcctcccacagccagcggatcataggcgcccacttctcccctggg
ctccagtacttcgggcagtctctgagtgggggtaaggatctcacaatggatggcttgatg
gacctggctgttggggcgcaggggcatcttctgctgctcagagcccagccggtgctgaga
ctggaggcaaccatggaattcagccccaagaaagtagcaaggagtgtgtttgcatgtcaa
gaacaagtattaaaaaacaaggatgctggggaggtcagagtctgcctccgtgtccgcaag
aacaccaaggaccgtctgcgcgaaggagatatccagagcactgtcacttatgacctggct
ttagaccctggccgctcacgtatccgtgccttctttgatgagacaaagaacaacacacgc
aggcgcacccaggtctttggattgatgcagaaatgtgaaacactgaagctaattttaccg
gactgcgtggacgactcagtgagccccatcatcctgcgcctcaattatacactggttggg
gagcccttgaggtcctttgggaacctccgaccagttctggctatggatgctcagaggttc
ttcacagctatgtttccctttgagaaaaattgcggcaatgacagcatctgccaagacgat
ctcagcatcaccatgagtgccatgggcttggacactttggtggtgggaggcccccaggac
tttaacatgagtgtgactctgagaaatgacggtgaggattcctacgggacccaggttacc
gtctactacccatctggcttatcttaccggaaggattcagcaagccagaacccgctcacc
aagaagccttggtttgtaaagcctgctgagtccagctcttcttctgaagggcatggggct
ctgaagagtaccacctggaacataaaccatcccatctttcctgctaattctgaggtcaca
tttaatgtcacatttgatgtggactctcatgcctcctttgggaacaaactgctcctcaaa
gccattgtggccagtgagaacaacatgtccaggacccacaaaaccaagtttcagttggag
ctgcctgtgaagtacgccatctacatgattgtcaccagtgatgagagttctatcagatat
ctcaacttcacggcttcagagatgaccagtaaggtcatacagcatcagtaccagttcaac
aacctgggccagaggagcctccctgtcagtgtagtcttctggatccctgttcagatcaac
aatgtgaccgtatgggatcatccccaggtcatcttctcccagaacctctcaagtgcctgt
cacactgagcagaaatccccccctcactccaatttccgggatcagcttgaaaggacccca
gtgctgaactgctctgttgcagtctgtaagagaattcagtgtgaccttccatccttcaac
actcaggaaatattcaatgtcaccctcaagggcaacctatcatttgactggtacatcaag
acttctcatggtcacctcctgcttgtgagcagcactgagatcctgtttaatgactctgcg
tttgccctgcttccagggcaggagtcgtatgtgaggtctaagacagagaccaaagtggag
ccatatgaagttcacaatcctgtaccactcattgtgggcagctccattgggggcctggtg
ctcttggctctcatcactgctggcctatacaagcttggctttttcaagcggcagtacaag
gacatgatgaatgaagctgccccccaagacgccccacctcagtaa

DBGET integrated database retrieval system