KEGG   Mus musculus (mouse): 16420Help
Entry
16420             CDS       T01002                                 

Gene name
Itgb6, 2210409C20Rik, 4831415H04Rik
Definition
(RefSeq) integrin beta 6
  KO
K06589  integrin beta 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    16420 (Itgb6)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    16420 (Itgb6)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    16420 (Itgb6)
  Cell motility
   04810 Regulation of actin cytoskeleton
    16420 (Itgb6)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    16420 (Itgb6)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16420 (Itgb6)
   05414 Dilated cardiomyopathy (DCM)
    16420 (Itgb6)
  Infectious diseases
   05165 Human papillomavirus infection
    16420 (Itgb6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16420 (Itgb6)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   16420 (Itgb6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2
Motif
Other DBs
NCBI-GeneID: 16420
NCBI-ProteinID: NP_001153036
MGI: 96615
Ensembl: ENSMUSG00000026971
Vega: OTTMUSG00000012790
UniProt: Q9Z0T9
Position
2 C1.2; 2 34.81 cM
AA seq 787 aa AA seqDB search
MGIELVCLFLLLLGRNDHVQGGCAWGGAESCSDCLLTGPHCAWCSQENFTHLSGAGERCD
TPANLLAKGCQLPFIENPVSRIEVLQNKPLSVGRQKNSSDIVQIAPQSLVLKLRPGREQT
LQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLAKEMSKLTSNFRLGFGSFVEK
PVSPFMKTTPEEITNPCSSIPYFCLPTFGFKHILPLTDDAERFNEIVRKQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDHRNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTALCNNGVLFPHQKKCSHMKVGDTASFNVT
VSVSNCEKRSRNLIIKPVGLGDTLEILVSAECDCDCQREIETNSSKCHNGNGSFQCGVCT
CNPGHMGPHCECGEDMVSTDSCKESPGHPSCSGRGDCYCGQCICHLSPYGSIYGPYCQCD
NFSCLRHKGLLCGDNGDCDCGECVCRDGWTGEYCNCTTNRDSCTSEDGVLCSGRGDCVCG
KCVCRNPGASGPTCERCPTCGDPCNSKRSCIECYLSADGQAQEECADKCKAIGATISEED
FSKDTSVSCSLQGENECLITFLITTDNEGKTIIHNINEKDCPKPPNIPMIMLGVSLAILL
IGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKHK
AGLSSDG
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggggattgagctggtctgcctgtttctgctacttctaggaaggaatgatcacgtccaa
ggtggctgtgcctggggtggtgcagaaagctgctcagactgcctgctcacaggaccccac
tgcgcctggtgctcccaggagaatttcacccacctgtctggagctggcgagaggtgcgac
accccagcgaatcttttagccaaaggatgtcaactacccttcattgaaaaccctgtctcc
cgcatagaagtccttcaaaataagcctctcagcgtgggccgacagaagaacagttctgac
attgttcagattgctcctcaaagcttggttcttaaattgagaccagggcgtgagcagact
ctgcaagtgcaggtccgccaaactgaagattacccagtagatctgtattacctcatggac
ctctccgcctctatggatgacgacctcaacaccatcaaagagcttggctcccggctggcc
aaagagatgtccaaactaaccagcaactttagactgggctttggctcttttgtggaaaag
cccgtttctccttttatgaaaacaaccccagaggaaatcaccaacccttgcagtagtatc
ccctatttctgcttacctacatttggattcaagcacattttgccattaactgatgatgcc
gagagattcaatgaaattgtgaggaaacagaagatttctgctaatattgacacacctgaa
ggtggatttgatgcaatcatgcaggctgctgtgtgtaaggaaaagattggctggcgcaat
gactcgctccacctcctggtttttgtgagtgatgccgattctcattttggaatggacagc
aagctggcaggcattgtcattcccaatgatggactctgtcacttggaccacaggaatgaa
tattccatgtcaactgtcttggaatatccaactatcggccaactcattgataaactggta
caaaacaacgtgctactgatctttgcagtcacccaagaacaagtccatctgtatgagaac
tatgcaaaactcattcctggagcaaccgtgggactgcttcagaaggattctgggaacatc
cttcagctgatcatctccgcttatgaagaactgcggtctgaggtggaactggaagtgtta
ggggacacagaaggactcaacctgtctttcacagctctctgtaacaatggtgtcctcttc
ccacaccaaaagaaatgctcccacatgaaagttggagacacagcatccttcaatgtgact
gtgagcgtatccaactgtgagaaaagaagcaggaacctcatcataaagccagtggggctg
ggggacaccctagaaatactcgtcagtgcagaatgtgactgcgactgccagagagaaata
gaaactaacagctctaagtgtcacaatgggaatggctccttccagtgtggggtgtgtacc
tgcaaccccggccacatgggtcctcactgcgagtgtggtgaggatatggtgagcacggat
tcctgcaaggagtccccgggtcacccttcatgcagtggaaggggtgactgctattgtggg
cagtgcatctgccacttatcgccgtacggaagcatctacggaccttactgccagtgtgac
aacttctcctgtctgagacacaaaggccttctctgtggagataacggtgactgtgactgt
ggcgagtgtgtgtgccgggatggctggacaggtgaatactgtaactgtacaaccaacagg
gactcgtgtacatctgaggatggagtgctgtgcagtggacgtggggactgtgtctgtggc
aagtgtgtctgcagaaaccctggagcctcaggacccacctgtgaacgctgtcctacctgt
ggcgacccctgtaactctaaacggagttgcatcgagtgctacctgtctgcagatggccag
gcccaagaagagtgtgctgacaagtgtaaagccattggtgccaccatcagtgaggaagat
ttttcaaaggatacttctgtctcctgctctctacaaggagaaaatgaatgccttattaca
ttcctaataactacggataatgaagggaaaaccatcattcacaacatcaatgaaaaagac
tgccccaaacctccaaacattcccatgatcatgttgggggtgtcactggcgatcctgctc
atcggagttgtgctactgtgcatttggaagctgctggtatcatttcatgaccggaaggaa
gttgctaaatttgaagcagaacgctctaaggccaagtggcaaacgggaaccaatcctctg
taccgaggttccaccagcacttttaagaacgtgacctacaagcacagggagaagcacaaa
gcaggcctttcctcagatgggtag

DBGET integrated database retrieval system