KEGG   Mus musculus (mouse): 16420Help
Entry
16420             CDS       T01002                                 

Gene name
Itgb6, 2210409C20Rik, 4831415H04Rik
Definition
integrin beta 6
Orthology
K06589  
integrin beta 6
Organism
mmu  Mus musculus (mouse)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mmu04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:mmu04512]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mmu04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:mmu04510]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:mmu05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:mmu05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:mmu05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 C3; 2 34.81 cM
AA seq 787 aa AA seqDB search
MGIELVCLFLLLLGRNDHVQGGCAWGGAESCSDCLLTGPHCAWCSQENFTHLSGAGERCD
TPANLLAKGCQLPFIENPVSRIEVLQNKPLSVGRQKNSSDIVQIAPQSLVLKLRPGREQT
LQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLAKEMSKLTSNFRLGFGSFVEK
PVSPFMKTTPEEITNPCSSIPYFCLPTFGFKHILPLTDDAERFNEIVRKQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDHRNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTALCNNGVLFPHQKKCSHMKVGDTASFNVT
VSVSNCEKRSRNLIIKPVGLGDTLEILVSAECDCDCQREIETNSSKCHNGNGSFQCGVCT
CNPGHMGPHCECGEDMVSTDSCKESPGHPSCSGRGDCYCGQCICHLSPYGSIYGPYCQCD
NFSCLRHKGLLCGDNGDCDCGECVCRDGWTGEYCNCTTNRDSCTSEDGVLCSGRGDCVCG
KCVCRNPGASGPTCERCPTCGDPCNSKRSCIECYLSADGQAQEECADKCKAIGATISEED
FSKDTSVSCSLQGENECLITFLITTDNEGKTIIHNINEKDCPKPPNIPMIMLGVSLAILL
IGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKHK
AGLSSDG
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggggattgagctggtctgcctgtttctgctacttctaggaaggaatgatcacgtccaa
ggtggctgtgcctggggtggtgcagaaagctgctcagactgcctgctcacaggaccccac
tgcgcctggtgctcccaggagaatttcacccacctgtctggagctggcgagaggtgcgac
accccagcgaatcttttagccaaaggatgtcaactacccttcattgaaaaccctgtctcc
cgcatagaagtccttcaaaataagcctctcagcgtgggccgacagaagaacagttctgac
attgttcagattgctcctcaaagcttggttcttaaattgagaccagggcgtgagcagact
ctgcaagtgcaggtccgccaaactgaagattacccagtagatctgtattacctcatggac
ctctccgcctctatggatgacgacctcaacaccatcaaagagcttggctcccggctggcc
aaagagatgtccaaactaaccagcaactttagactgggctttggctcttttgtggaaaag
cccgtttctccttttatgaaaacaaccccagaggaaatcaccaacccttgcagtagtatc
ccctatttctgcttacctacatttggattcaagcacattttgccattaactgatgatgcc
gagagattcaatgaaattgtgaggaaacagaagatttctgctaatattgacacacctgaa
ggtggatttgatgcaatcatgcaggctgctgtgtgtaaggaaaagattggctggcgcaat
gactcgctccacctcctggtttttgtgagtgatgccgattctcattttggaatggacagc
aagctggcaggcattgtcattcccaatgatggactctgtcacttggaccacaggaatgaa
tattccatgtcaactgtcttggaatatccaactatcggccaactcattgataaactggta
caaaacaacgtgctactgatctttgcagtcacccaagaacaagtccatctgtatgagaac
tatgcaaaactcattcctggagcaaccgtgggactgcttcagaaggattctgggaacatc
cttcagctgatcatctccgcttatgaagaactgcggtctgaggtggaactggaagtgtta
ggggacacagaaggactcaacctgtctttcacagctctctgtaacaatggtgtcctcttc
ccacaccaaaagaaatgctcccacatgaaagttggagacacagcatccttcaatgtgact
gtgagcgtatccaactgtgagaaaagaagcaggaacctcatcataaagccagtggggctg
ggggacaccctagaaatactcgtcagtgcagaatgtgactgcgactgccagagagaaata
gaaactaacagctctaagtgtcacaatgggaatggctccttccagtgtggggtgtgtacc
tgcaaccccggccacatgggtcctcactgcgagtgtggtgaggatatggtgagcacggat
tcctgcaaggagtccccgggtcacccttcatgcagtggaaggggtgactgctattgtggg
cagtgcatctgccacttatcgccgtacggaagcatctacggaccttactgccagtgtgac
aacttctcctgtctgagacacaaaggccttctctgtggagataacggtgactgtgactgt
ggcgagtgtgtgtgccgggatggctggacaggtgaatactgtaactgtacaaccaacagg
gactcgtgtacatctgaggatggagtgctgtgcagtggacgtggggactgtgtctgtggc
aagtgtgtctgcagaaaccctggagcctcaggacccacctgtgaacgctgtcctacctgt
ggcgacccctgtaactctaaacggagttgcatcgagtgctacctgtctgcagatggccag
gcccaagaagagtgtgctgacaagtgtaaagccattggtgccaccatcagtgaggaagat
ttttcaaaggatacttctgtctcctgctctctacaaggagaaaatgaatgccttattaca
ttcctaataactacggataatgaagggaaaaccatcattcacaacatcaatgaaaaagac
tgccccaaacctccaaacattcccatgatcatgttgggggtgtcactggcgatcctgctc
atcggagttgtgctactgtgcatttggaagctgctggtatcatttcatgaccggaaggaa
gttgctaaatttgaagcagaacgctctaaggccaagtggcaaacgggaaccaatcctctg
taccgaggttccaccagcacttttaagaacgtgacctacaagcacagggagaagcacaaa
gcaggcctttcctcagatgggtag

DBGET integrated database retrieval system