KEGG   Mus musculus (mouse): 16420Help
Entry
16420             CDS       T01002                                 

Gene name
Itgb6, 2210409C20Rik, 4831415H04Rik
Definition
integrin beta 6
Orthology
K06589  
integrin beta 6
Organism
mmu  Mus musculus (mouse)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    16420 (Itgb6)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    16420 (Itgb6)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    16420 (Itgb6)
  Cell communication
   04510 Focal adhesion
    16420 (Itgb6)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    16420 (Itgb6)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16420 (Itgb6)
   05414 Dilated cardiomyopathy (DCM)
    16420 (Itgb6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16420 (Itgb6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 C3; 2 34.81 cM
AA seq 787 aa AA seqDB search
MGIELVCLFLLLLGRNDHVQGGCAWGGAESCSDCLLTGPHCAWCSQENFTHLSGAGERCD
TPANLLAKGCQLPFIENPVSRIEVLQNKPLSVGRQKNSSDIVQIAPQSLVLKLRPGREQT
LQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLAKEMSKLTSNFRLGFGSFVEK
PVSPFMKTTPEEITNPCSSIPYFCLPTFGFKHILPLTDDAERFNEIVRKQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDHRNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTALCNNGVLFPHQKKCSHMKVGDTASFNVT
VSVSNCEKRSRNLIIKPVGLGDTLEILVSAECDCDCQREIETNSSKCHNGNGSFQCGVCT
CNPGHMGPHCECGEDMVSTDSCKESPGHPSCSGRGDCYCGQCICHLSPYGSIYGPYCQCD
NFSCLRHKGLLCGDNGDCDCGECVCRDGWTGEYCNCTTNRDSCTSEDGVLCSGRGDCVCG
KCVCRNPGASGPTCERCPTCGDPCNSKRSCIECYLSADGQAQEECADKCKAIGATISEED
FSKDTSVSCSLQGENECLITFLITTDNEGKTIIHNINEKDCPKPPNIPMIMLGVSLAILL
IGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKHK
AGLSSDG
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggggattgagctggtctgcctgtttctgctacttctaggaaggaatgatcacgtccaa
ggtggctgtgcctggggtggtgcagaaagctgctcagactgcctgctcacaggaccccac
tgcgcctggtgctcccaggagaatttcacccacctgtctggagctggcgagaggtgcgac
accccagcgaatcttttagccaaaggatgtcaactacccttcattgaaaaccctgtctcc
cgcatagaagtccttcaaaataagcctctcagcgtgggccgacagaagaacagttctgac
attgttcagattgctcctcaaagcttggttcttaaattgagaccagggcgtgagcagact
ctgcaagtgcaggtccgccaaactgaagattacccagtagatctgtattacctcatggac
ctctccgcctctatggatgacgacctcaacaccatcaaagagcttggctcccggctggcc
aaagagatgtccaaactaaccagcaactttagactgggctttggctcttttgtggaaaag
cccgtttctccttttatgaaaacaaccccagaggaaatcaccaacccttgcagtagtatc
ccctatttctgcttacctacatttggattcaagcacattttgccattaactgatgatgcc
gagagattcaatgaaattgtgaggaaacagaagatttctgctaatattgacacacctgaa
ggtggatttgatgcaatcatgcaggctgctgtgtgtaaggaaaagattggctggcgcaat
gactcgctccacctcctggtttttgtgagtgatgccgattctcattttggaatggacagc
aagctggcaggcattgtcattcccaatgatggactctgtcacttggaccacaggaatgaa
tattccatgtcaactgtcttggaatatccaactatcggccaactcattgataaactggta
caaaacaacgtgctactgatctttgcagtcacccaagaacaagtccatctgtatgagaac
tatgcaaaactcattcctggagcaaccgtgggactgcttcagaaggattctgggaacatc
cttcagctgatcatctccgcttatgaagaactgcggtctgaggtggaactggaagtgtta
ggggacacagaaggactcaacctgtctttcacagctctctgtaacaatggtgtcctcttc
ccacaccaaaagaaatgctcccacatgaaagttggagacacagcatccttcaatgtgact
gtgagcgtatccaactgtgagaaaagaagcaggaacctcatcataaagccagtggggctg
ggggacaccctagaaatactcgtcagtgcagaatgtgactgcgactgccagagagaaata
gaaactaacagctctaagtgtcacaatgggaatggctccttccagtgtggggtgtgtacc
tgcaaccccggccacatgggtcctcactgcgagtgtggtgaggatatggtgagcacggat
tcctgcaaggagtccccgggtcacccttcatgcagtggaaggggtgactgctattgtggg
cagtgcatctgccacttatcgccgtacggaagcatctacggaccttactgccagtgtgac
aacttctcctgtctgagacacaaaggccttctctgtggagataacggtgactgtgactgt
ggcgagtgtgtgtgccgggatggctggacaggtgaatactgtaactgtacaaccaacagg
gactcgtgtacatctgaggatggagtgctgtgcagtggacgtggggactgtgtctgtggc
aagtgtgtctgcagaaaccctggagcctcaggacccacctgtgaacgctgtcctacctgt
ggcgacccctgtaactctaaacggagttgcatcgagtgctacctgtctgcagatggccag
gcccaagaagagtgtgctgacaagtgtaaagccattggtgccaccatcagtgaggaagat
ttttcaaaggatacttctgtctcctgctctctacaaggagaaaatgaatgccttattaca
ttcctaataactacggataatgaagggaaaaccatcattcacaacatcaatgaaaaagac
tgccccaaacctccaaacattcccatgatcatgttgggggtgtcactggcgatcctgctc
atcggagttgtgctactgtgcatttggaagctgctggtatcatttcatgaccggaaggaa
gttgctaaatttgaagcagaacgctctaaggccaagtggcaaacgggaaccaatcctctg
taccgaggttccaccagcacttttaagaacgtgacctacaagcacagggagaagcacaaa
gcaggcctttcctcagatgggtag

DBGET integrated database retrieval system