KEGG   Mus musculus (mouse): 16438Help
Entry
16438             CDS       T01002                                 

Gene name
Itpr1, D6Pas2, Gm10429, IP3R1, InsP3R, Ip3r, Itpr-1, P400, Pcp-1, Pcp1, opt, wblo
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor 1
  KO
K04958  
inositol 1,4,5-triphosphate receptor type 1
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Apoptosis
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Estrogen signaling pathway
Thyroid hormone synthesis
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Aldosterone synthesis and secretion
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    16438 (Itpr1)
   04070 Phosphatidylinositol signaling system
    16438 (Itpr1)
   04022 cGMP - PKG signaling pathway
    16438 (Itpr1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    16438 (Itpr1)
   04210 Apoptosis
    16438 (Itpr1)
  Cellular commiunity
   04540 Gap junction
    16438 (Itpr1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    16438 (Itpr1)
  Endocrine system
   04922 Glucagon signaling pathway
    16438 (Itpr1)
   04912 GnRH signaling pathway
    16438 (Itpr1)
   04915 Estrogen signaling pathway
    16438 (Itpr1)
   04921 Oxytocin signaling pathway
    16438 (Itpr1)
   04918 Thyroid hormone synthesis
    16438 (Itpr1)
   04924 Renin secretion
    16438 (Itpr1)
   04925 Aldosterone synthesis and secretion
    16438 (Itpr1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    16438 (Itpr1)
  Digestive system
   04970 Salivary secretion
    16438 (Itpr1)
   04971 Gastric acid secretion
    16438 (Itpr1)
   04972 Pancreatic secretion
    16438 (Itpr1)
  Nervous system
   04724 Glutamatergic synapse
    16438 (Itpr1)
   04725 Cholinergic synapse
    16438 (Itpr1)
   04728 Dopaminergic synapse
    16438 (Itpr1)
   04726 Serotonergic synapse
    16438 (Itpr1)
   04720 Long-term potentiation
    16438 (Itpr1)
   04730 Long-term depression
    16438 (Itpr1)
   04723 Retrograde endocannabinoid signaling
    16438 (Itpr1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    16438 (Itpr1)
  Environmental adaptation
   04713 Circadian entrainment
    16438 (Itpr1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    16438 (Itpr1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    16438 (Itpr1)
   05016 Huntington's disease
    16438 (Itpr1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     16438 (Itpr1)
Ion channels [BR:mmu04040]
 Ryanodine and IP3 receptors
  IP3 receptor
   16438 (Itpr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6 E1-E2; 6 49.74 cM
AA seq 2749 aa AA seqDB search
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPLKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAK
EGQKEDRDILSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRAS
FCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFV
EEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHV
TTIFPISKMTKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAEP
EKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQSSETSSGNSSQEG
PSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGAL
QLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPD
EPMDGASGENEHKKTEEGTSKPLKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQ
QQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHIN
LFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEG
KFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVEL
LAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEI
YTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTT
LQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNN
LFLKSHNIVQKTALNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQA
ELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLRE
MMTKDRGYGEKQISIDESENAELPQAPEAENSTEQELEPSPPLRQLEDHKRGEALRQILV
NRYYGNIRPSGRRESLTSFGNGPLSPGGPSKPGGGGGGPGSSSTSRGEMSLAEVQCHLDK
EGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFY
DRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASA
ATRKAFTTFRREADPDDHYQSGEGTQATTDKAKDDLEMSAVITIMQPILRFLQLLCENHN
RDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLT
EYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNASKLLLAIME
SRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPRNVGHNIYILAH
QLARHNKELQTMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVPSICEFLTK
ESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWSSISF
NLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKPHGIRALIASTI
LRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVEFLYHLLYLLI
CAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYL
FFKDDFILEVDRLPNETAVPETGESLANDFLYSDVCRVETGENCTSPAPKEELLPAEETE
QDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIV
LNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHY
LCFIVLVKVKDSTEYTGPESYVAEMIRERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEK
LESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8250 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaatgtcgagtttcctacatattggagacatttgttctctgtatgcggag
ggatctacgaatggatttatcagcaccttaggcttggttgatgaccgttgtgttgtacag
ccagaagccggggaccttaacaatccacccaagaaattcagagactgcctctttaagcta
tgtcctatgaatcgatactccgcacagaaacagttctggaaagctgctaagcccggggcc
aacagcactacagatgcagtgctgctcaacaaattgcatcatgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgttggggaccgtcatccaatatggcaacgtg
atccagctcctgcatttgaaaagcaataaatacctgactgtgaataagaggctcccagcc
ttgctagagaagaacgccatgagggtgacgttggacgaggctggaaatgaagggtcctgg
ttttacattcaaccattctacaagcttcgctccatcggagacagtgtggtcataggcgac
aaggtagttttgaatcctgtcaatgctggccagcctctacatgccagcagtcatcagctg
gtggataacccaggctgcaatgaggtcaactccgtcaactgtaatacaagctggaagata
gtgcttttcatgaaatggagtgataacaaagacgatattctcaaaggaggtgatgtggtg
aggctcttccatgccgagcaagagaagtttctcacctgcgatgagcaccggaagaagcag
catgtgttcctgaggaccaccggcaggcagtcagccacatcggccaccagttccaaagcc
ctgtgggaagtggaggtagtccagcacgacccatgtcggggtggagctgggtactggaat
agcctcttccggttcaagcacctggctacagggcattacttggctgcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcagtggaccctgatcaggatgcatct
cggagtaggttgagaaacgcgcaagaaaaaatggtatactctctggtctccgtgcctgaa
ggcaacgacatctcctccatctttgagctagaccccacgactctgcgtggaggtgacagc
cttgtcccaaggaactcctatgtccgtctcagacacctgtgcaccaacacctgggtacac
agcacaaacatccccatcgacaaggaagaggagaagcctgtgatgctgaaaattggtacc
tctcccctgaaggaggacaaggaagcatttgccatagttcctgtttcccctgctgaggtt
cgggacctggactttgccaatgatgccagcaaggtgctgggctccatcgctgggaagttg
gaaaagggcacaatcacccagaatgagagaaggtctgtcacgaagcttttggaagacttg
gtttactttgtcacgggtggaactaactctggccaagacgtgcttgaagttgtcttctct
aagcccaatcgagagcggcagaagctgatgagggaacagaatattctcaagcagatcttc
aagctgttgcaggcccccttcacggactgcggggatggcccgatgcttcggctggaggag
ctgggggatcagcgccatgctcctttcagacatatttgccgactctgctacagggtcctg
cgacactcacagcaagactacaggaagaaccaggagtacatagccaagcagtttggcttc
atgcagaagcagattggctatgacgtgctggccgaagacaccatcactgccctgctccac
aacaaccggaaactcctggagaagcacatcaccgcggcagagattgacacgtttgtcagc
ctggtgcgaaagaacagggagcccaggttcttggattacctctctgacctctgcgtatcc
atgaacaagtcaatccctgtgacacaggagctcatctgtaaagctgtgctcaatcccacc
aatgctgacatcctgattgagaccaagctggttctttctcgttttgagtttgaaggcgtt
tccactggagagaatgctctggaagccggggaggatgaggaagaggtgtggctgttctgg
agggacagcaacaaagagatccgtagtaagagtgtccgggaattggcgcaagatgctaaa
gagggacagaaggaagacagggacatcctcagctactacagatatcagctgaacctcttt
gcaaggatgtgtctggaccgccagtacctggccatcaatgaaatctccgggcagctggat
gttgatctcattctccgctgcatgtctgacgagaacctcccctacgacctcagggcatcc
ttttgccgcctcatgcttcacatgcatgtggaccgagatccccaagagcaggtgacacct
gtgaaatatgcccgactgtggtcagaaattccctctgagatcgccattgatgactatgac
agcagtggaacatccaaagatgaaattaaggagaggtttgcacagacgatggagtttgtg
gaggagtacctaagagatgtggtttgtcaaagattccccttctctgataaggagaaaaat
aagctcacgtttgaggttgtgaacttagccaggaatctcatatactttggtttctacaac
ttttctgaccttctccgattaaccaagatcctcttggcaatcttagactgtgtccatgtg
accactatcttccccattagcaagatgacaaaaggagaagagaataaaggcagtaacgtg
atgaggtctatccatggcgttggggagctgatgacccaggtggtgctgcggggaggaggc
ttcttgcccatgactcccatggctgcggcccctgaaggaaatgtgaagcaggcagagcca
gagaaagaggacatcatggtcatggacaccaagttgaagatcattgaaatactccagttt
attttgaatgtgagattggattataggatctcctgcctcctgtgtatatttaagcgagag
tttgatgaaagcaattcccagtcatcagaaacatcctccggaaacagcagccaggaaggg
ccaagtaatgtgccaggtgctcttgactttgaacacattgaagaacaagcggaaggcatc
tttggaggaagtgaggagaacacacctttggacctggatgaccatggtggcagaaccttc
ctcagggtcctgctccacttgacaatgcatgactacccacccctggtgtctggggccctg
cagctcctctttcggcacttcagccagaggcaggaggtccttcaggccttcaaacaggtt
caactgctggttactagccaagatgtggacaactacaaacagatcaagcaagacttggac
caactaaggtccattgtggagaagtctgagctctgggtgtacaaaggccaaggtcccgat
gagcctatggacggagcctccggtgaaaatgagcataagaaaaccgaggaggggacgagc
aagccactgaagcacgagagcaccagcagctacaactaccgagtggtgaaagagattttg
attcgacttagcaagctctgcgtgcaggagagcgcgtcggtgaggaagagccggaagcag
cagcaacgactgctgaggaacatgggcgcacacgctgtggtgctggagctgctgcagatc
ccctacgagaaggccgaagacacaaagatgcaagagatcatgcggctggctcatgaattt
ttgcagaatttctgtgcaggcaaccagcagaatcaagctttgctgcataaacacataaac
ctgtttctcaacccagggatcctggaggcagtgacgatgcagcacatcttcatgaacaac
ttccagctgtgcagtgagatcaacgagagagtggtccagcactttgttcactgcatagag
acccacggtcgaaacgtccagtatatcaagtttctccagacgattgtcaaggcagaaggg
aaattcattaaaaagtgccaagacatggtcatggctgagcttgtcaactctggagaggac
gtcctcgtgttctacaatgacagagcctctttccagactctgatccagatgatgcggtcc
gagcgtgaccggatggatgagaacagccctctcatgtaccacatccatctggtggagctc
ttggccgtgtgcacagagggcaagaatgtgtacacggagatcaagtgcaactccttgctc
ccgctcgatgacatcgttcgtgtggtcactcatgaagactgcatccccgaggttaagatc
gcttacattaacttcctgaatcactgctatgtggatacggaggtggagatgaaggagatt
tacacaagcaaccacatgtggaagttgtttgagaatttcctcgtggacatctgcagggcc
tgtaacaacacaagcgacaggaagcacgcagactccattctggagaagtacgtcactgaa
atcgtgatgagcatcgtcaccaccttcttcagctctcccttctcagaccagagcaccact
ctgcagacccgccagcctgtctttgtgcaactcctgcaaggcgtgttccgagtttaccac
tgcaactggctgatgccgagccaaaaagcctcggtggagagctgcatccgggtgctctct
gacgtagccaagagccgggccatagccattcctgttgacctggacagccaagtcaacaac
ctcttcctgaagtcccacaacattgtgcagaaaacagccctgaactggcggttatcagcc
cgaaacgccgctcgcagagactctgtactggcagcatccagagactaccgaaatatcatt
gagaggttacaggacatcgtgtctgccctagaggaccggctcaggcccctggtgcaggct
gagctgtctgtgctcgtggatgttctacacagaccagaactgctcttccccgagaacacg
gatgccaggaggaaatgtgagagtggaggtttcatctgcaagctaataaaacataccaag
caactgctggaggagaatgaagagaaactatgcattaaagtcttacagaccctcagggaa
atgatgaccaaagacagaggctatggagagaagcaaatttccattgatgaatcggaaaat
gccgagctgccacaggcaccggaagctgagaactccacagagcaggagcttgaaccaagt
ccacccctgaggcaactggaagaccataaaaggggtgaggcactccgacaaattttggtc
aaccgttactatggaaacatcagaccttcaggaagaagagagagccttaccagctttggc
aatggcccactatcaccaggaggacccagcaagcctggtggaggagggggaggtcctgga
tctagttccacaagcaggggtgagatgagcctggctgaggttcagtgtcacctcgacaag
gagggggcctccaacctggtcatcgatctcataatgaatgcatccagtgaccgagtattc
catgaaagcattctgctggccatcgcacttctggaaggaggcaacaccaccatccagcac
tcgtttttctgccggctgacagaagataagaaatcagagaagttcttcaaggttttttac
gatcgaatgaaggtggcccagcaggaaatcaaggcgacagtgacagtgaacaccagcgac
ttgggaaacaaaaagaaagatgatgaagtggacagggatgccccgtctcggaagaaagcc
aaagagcccacaacacagataacagaagaggtccgggatcagctcctggaagcatctgct
gccaccaggaaagcctttaccaccttccggagggaggccgaccctgatgaccattaccag
tctggggagggcacccaggctacaaccgacaaagccaaggatgacctagagatgagcgct
gtcatcaccatcatgcagcctatcctgcgcttcctgcagctgctgtgtgaaaaccacaac
cgagatctgcagaatttccttcgttgccaaaataataagaccaactacaatttggtgtgt
gagacactgcagtttctggactgtatttgtgggagcacaaccggaggccttggtcttctt
ggactgtacataaatgaaaagaatgtagcacttatcaaccaaaccctggagagtctgacg
gagtactgtcaagggccttgccatgagaaccagaactgcatcgccacccacgagtccaat
ggcatcgatatcatcacagccctcatcctcaatgatatcaaccctctgggaaagaagcgg
atggacctggtgttagaactgaagaacaatgcttcgaagctgctactggccatcatggaa
agcagacacgatagtgaaaatgcagagaggatcctgtacaacatgaggcccaaggagctg
gtggaagtgatcaagaaggcctacatgcaaggtgaagtggaatttgaggatggggagaac
ggtgaggatggagctgcctcacccaggaacgtgggccacaacatctacatcctcgctcac
cagttggctcggcataacaaagaacttcaaaccatgctgaaacctggaggccaggtggat
ggggatgaagctctggagttctacgcgaagcacacagcacaaattgagattgtcagactg
gaccggacaatggaacagatcgtcttccctgtgcccagcatctgtgaattcctgactaag
gaatcgaaacttcgaatatattacaccacagagcgggatgagcaaggtagcaagatcaat
gacttcttcctgcgctccgaggacctctttaacgagatgaactggcagaagaaacttcga
gcccagcctgtcttgtactggtgtgcccgaaacatgtctttctggagcagcatctccttc
aacctggccgtcctgatgaacctgctggtggcgtttttctatccatttaaaggagtaagg
ggaggaacactagagccacactggtcaggccttctgtggacagccatgctcatctctctg
gccattgtcattgctctgcccaagccccacggcatccgggccttaattgcttctacaatc
ctacgactgatattttcagttgggttgcagcccacactgtttctgctgggagctttcaat
gtctgcaataaaatcatcttcctgatgagctttgtgggcaactgtgggaccttcaccaga
ggctaccgggccatggttctggatgtggagttcctctatcatttgctgtatctactcatc
tgtgccatgggcctcttcgtacatgagttcttctatagcttgctgctttttgatttagtg
tacagagaggagactttgcttaatgtcattaaaagtgtcacccgcaatggacggtccatc
atcttgacagcggtcctggctctgatcctggtttacctgttctcaattgtgggctatctg
ttcttcaaggatgactttatcttggaagtagataggttgcccaatgaaacagctgttcca
gaaactggcgagagtttggccaacgatttcctgtactctgatgtgtgcagggtagagacg
ggggagaactgcacctctcctgcacccaaagaagagctgctccctgccgaagaaacggaa
caggataaggaacacacgtgtgagaccctgctcatgtgcatcgtcactgttctgagtcac
gggctgcggagtgggggaggggtaggagacgtgctcaggaagccatccaaagaggagcct
ctgtttgctgcaagggtgatctacgacctcctcttcttcttcatggtcatcatcatcgtc
ctgaacctgattttcggggtcatcattgacacctttgctgacctgaggagtgagaagcaa
aagaaggaggagatcttaaaaaccacgtgcttcatctgcggcttggaaagggacaagttt
gacaataagactgtcacctttgaagagcacatcaaggaagagcacaacatgtggcactat
ctgtgcttcatcgtgctggtgaaagtgaaggactccacagagtacaccgggcctgagagt
tacgtggcagagatgatcagggaaagaaaccttgattggttccccagaatgagagccatg
tccctggtcagcagcgattctgaaggggaacagaacgagctgaggaacctgcaggagaag
ctggagtctaccatgaagctggtcaccaatctttctggccagctgtcagaactaaaggac
cagatgacagaacagaggaagcagaaacaaagaatcggccttctaggacatcctcctcac
atgaatgtcaacccacagcagccggcctag

DBGET integrated database retrieval system