KEGG   Mus musculus (mouse): 16439Help
Entry
16439             CDS       T01002                                 

Gene name
Itpr2, AI649341, InsP3R-2, InsP3R-5, Ip3r2, Itpr5, insP3R2
Definition
(RefSeq) inositol 1,4,5-triphosphate receptor 2
  KO
K04959  
inositol 1,4,5-triphosphate receptor type 2
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Apoptosis
Vascular smooth muscle contraction
Gap junction
Platelet activation
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Estrogen signaling pathway
Thyroid hormone synthesis
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Aldosterone synthesis and secretion
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    16439 (Itpr2)
   04070 Phosphatidylinositol signaling system
    16439 (Itpr2)
   04022 cGMP - PKG signaling pathway
    16439 (Itpr2)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    16439 (Itpr2)
   04210 Apoptosis
    16439 (Itpr2)
  Cellular community
   04540 Gap junction
    16439 (Itpr2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    16439 (Itpr2)
  Endocrine system
   04922 Glucagon signaling pathway
    16439 (Itpr2)
   04912 GnRH signaling pathway
    16439 (Itpr2)
   04915 Estrogen signaling pathway
    16439 (Itpr2)
   04921 Oxytocin signaling pathway
    16439 (Itpr2)
   04918 Thyroid hormone synthesis
    16439 (Itpr2)
   04924 Renin secretion
    16439 (Itpr2)
   04925 Aldosterone synthesis and secretion
    16439 (Itpr2)
  Circulatory system
   04270 Vascular smooth muscle contraction
    16439 (Itpr2)
  Digestive system
   04970 Salivary secretion
    16439 (Itpr2)
   04971 Gastric acid secretion
    16439 (Itpr2)
   04972 Pancreatic secretion
    16439 (Itpr2)
  Nervous system
   04724 Glutamatergic synapse
    16439 (Itpr2)
   04725 Cholinergic synapse
    16439 (Itpr2)
   04728 Dopaminergic synapse
    16439 (Itpr2)
   04726 Serotonergic synapse
    16439 (Itpr2)
   04720 Long-term potentiation
    16439 (Itpr2)
   04730 Long-term depression
    16439 (Itpr2)
   04723 Retrograde endocannabinoid signaling
    16439 (Itpr2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    16439 (Itpr2)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    16439 (Itpr2)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    16439 (Itpr2)
Ion channels [BR:mmu04040]
 Ryanodine and IP3 receptors
  IP3 receptor
   16439 (Itpr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 G3; 6 77.7 cM
AA seq 2701 aa AA seqDB search
MSDKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENRKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNVELLDNPGCKEVNAVNCNTSWKITLFMKFSSYREDVLKGGDVV
RLFHAEQEKFLTCDDYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNVKDGEIPTPKKKRQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTTIPIDTEEERPVMLKIGTC
QTKEDKEAFAIVCVPLSEVRDLDFANDANKVLATTVKKLENGSITQNERRFVTKLLEDLI
FFVADVTNNGQDVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYVLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNSTAIPVTQELICKFMLSPG
NADILIQTKLVSMQVENPMESSILPDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAREGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPM
SSYFERLSKFQDGSNNVMRTIHGVGEMMTQMVLSRGSIFPVSVPDAQPIVHPSKQASPGE
QEDVTVMDTKLKVIEILQFILSVRLDYRISYMLSIYKKEFGDNNDNGDPSASGTPDTLLP
SALVPDIDEIAAQAETMFAGRKEKTPVQLDDEGGRTFLRVLIHLIMHDYAPLLSGALQLL
FKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSGSYENGD
VGEGQAKGGEEANEESNLLSPVQDGAKTPQIDSNKGNNYRIVKEILIRLSKLCVQNKKCR
NQHQRLLKNMGAHSVVLDLLQIPYEKTDEKMNEVMDLAHTFLQNFCRGNPQNQVLLHKHL
NLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKAD
GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLNMMCSERARGDESGPLAYHITLVE
LLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKE
IYTSNHIWKLFENFLVDMARVCNTTTDRKHADTFLERCVTESVMNIVSGFFNSPFSDNST
SLQTHQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRALAEVAKNRGIAIPVDLDSQVN
TLFMKNHSSTVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEQQFSPM
MQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLRE
MLEKKDSFMEEGSTLRRILLNRYFKGDHSISVNGPLSGAYAKTAQVGGSFSGQDSDKKGI
SMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGILLGIALLEGGNTQTQYSFYQQLHEQ
KKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGSKKREEDSDVMALGPRMRVRDSSLHLR
EGMKGQLTEASSATSKAYCVYRREMDPEIDTMCPGQEAGSAEEKSAEEVTMSPAITIMRP
ILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINER
NVALVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQL
KNNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDEEGGDDGVS
PKDVGHNIYILAHQLARHNKLLQQMLKPGSDPEEGDEALKYYANHTAQIEIVRHDRTMEQ
IVFPVPNICEFLTRESKYRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALF
WFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPMFSVLLWVAVAICTSMLFF
FSKPVGIRPFLVSVMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAV
ILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAV
LALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGNHGVPTMTLSSMMETCQKENCSPT
IPSSNTAGEEGEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVY
DLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFE
EHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMITEKNLDWFPRMRAMSLVSNEGD
SEQNEIRNLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPP
H
NT seq 8106 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaatgtccagcttcctctacattggggacatcgtgtccctgtacgcggag
ggctcggtcaatggcttcatcagcaccctggggttggtggatgaccgttgtgtggtgcac
ccagaggcgggagaccttgccaacccacccaagaagttcagagactgcctgttcaaggtg
tgccctatgaatcgatactctgcccagaagcaatactggaaagccaagcaggcgaaacag
gggaaccatacagaggctgccctgctgaagaagctccagcatgctgcagagctggaacaa
aaacagaatgagtcggagaacaggaaacttttgggagaaatcgtgaaatacagcaacgtt
atccaactgctgcacataaaaagcaacaagtacctgacggtgaacaagaggttacctgcc
ttgctggagaagaatgccatgcgagtgtcactggatgctgcagggaacgaaggctcctgg
ttctacatccatccgttctggaagctgagaagcgagggtgataatatcgtcgtaggagat
aaagtcgttctgatgcctgtaaatgctgggcagcccctgcatgccagcaacgtggagctc
ttggacaacccaggctgcaaagaggtgaatgctgttaattgtaacactagctggaaaatc
actttattcatgaaattcagttcctatcgagaggatgtattaaaggggggtgatgttgtg
agactctttcatgcggaacaagagaaatttctgacctgtgatgactatgagaaaaaacag
cacattttccttcggacgaccttgcgtcaatcagcaacttcggccactagttctaaagca
ctctgggaaatagaggtggttcaccacgatccatgccgcggaggtgcgggacagtggaac
agcctgttcaggtttaagcatcttgccactgggaactacttagctgcagagcttaatcct
gactatcgagatgctcaaaatgaaggaaaaaatgtgaaagacggggagattccaacacca
aagaaaaaacgccaggcaggggagaagatcatgtacaccctggtttcagtcccacacgga
aatgacatcgcgtccctttttgaacttgatgccacaactctgcagagagccgactgcctg
gttccgaggaactcctacgtgcggttaaggcacttgtgcaccaacacctgggtaacaagc
accaccatccccatagacacagaggaagagaggcctgtcatgttgaaaattgggacctgc
cagaccaaggaagacaaagaagcctttgccattgtgtgcgtcccgctgtctgaggtccgt
gacttggactttgccaacgatgccaacaaagtgctggccaccacggtgaagaagctggag
aatggcagcatcacacagaacgagaggaggtttgtgactaagttgttggaagacctcatt
ttctttgtggctgatgtgaccaacaatgggcaggacgttctggatgtggtcatcaccaag
ccaaaccgggaacggcagaaactaatgagggaacagaatatactggcacaggtgtttggg
atccttaaagcacctttcaaggagaaggctggagaaggttcgatgctgaggctggaggac
ctgggcgaccagcgctacgccccgtacaagtatgtgctgcgtctctgctaccgtgtgctg
cggcattcgcagcaggactacaggaagaaccaggagtacattgctaagaacttctgcgtt
atgcagtcccagatcggctatgatatcttggcagaagatacgattacagccttgttacac
aacaaccgcaaactactggagaaacacatcacagccaaagaaattgagactttcgtcagc
ctgctcaggaggaaccgggagccgaggtttctggactatttgtctgacctctgtgtgtcc
aatagcacggccatccccgtcactcaggaactcatctgcaaattcatgctgagccctggc
aatgcggacatcctcattcagacaaagctggtgtccatgcaagtggagaaccccatggag
agctccatccttcctgatgacattgacgatgaggaggtctggctttactggattgacagc
aacaaggagcctcacggcaaggccatcaggcaccttgcccaggaagccagggaaggcacc
aaagctgacctggaagttctgacctattacaggtaccagctaaacctctttgcaaggatg
tgcttggaccgccagtatctggccatcaaccagatttcaacacagttgtccgtagacctg
atcctgcggtgtgtgtctgacgagagtctgccctttgacctcagagcatctttctgccga
ctcatgctccacatgcacgttgaccgcgacccccaggagtctgtagtgcctgttcgctat
gcccgcctctggaccgaaatccccacaaagatcacgattcatgagtatgactccattaca
gactcttccagaaatgacatgaagaggaagtttgccctgacgatggaatttgtcgaagaa
tatttgaaagaagttgtaaatcaaccatttccttttggagacaaagagaaaaataaactg
acatttgaggtggttcacctagcccggaacctcatctatttcggattctacagcttcagc
gagttactgcggctgacgagaactctgctggcgatcctagacatcgtccaggcccccatg
tcctcatatttcgaaagattaagcaagttccaagatggaagcaacaatgtcatgaggacc
atccacggagtgggagagatgatgacacagatggtgctcagcagaggctccatcttccca
gtgagtgtgcccgacgcacagcccatcgtccaccccagcaagcaggcgagccccggcgag
caggaggatgtgacagtgatggacaccaagctgaaggttatcgagattttacagttcatc
ctgagcgtcaggctggactaccggatctcttacatgctgtccatatacaagaaggaattt
ggagacaacaacgacaatggtgacccctctgccagcggcaccccagacacactgctacca
tcagctcttgtccctgacatcgacgagattgcggctcaggcagaaacaatgttcgctgga
agaaaagaaaaaactccagttcagcttgatgatgaaggaggcaggacgttcttacgcgtc
ctcatccacctgatcatgcacgactatgctccgctgctgtccggagccctgcagctgctc
ttcaagcatttcagccagagagcagaagtgcttcaggcctttaaacaggtgcagttacta
gtgtcgaaccaagatgttgataactacaagcaaatcaaggcagacctcgaccaacttcgg
ctgacggtggagaaatctgagctgtgggtagaaaagagcggcagctatgagaatggagat
gtgggtgagggccaggccaaaggaggcgaagaggcaaatgaggaatccaacctcttgagc
ccggtgcaggatggcgcgaagacacctcagatcgacagcaacaagggcaacaactaccgg
atcgtcaaggagatcttgattaggctgagtaagctctgtgtgcagaacaagaaatgccgt
aatcaacaccagcggctgctgaaaaacatgggggctcactccgtggtgctggaccttctg
cagatcccctatgagaagaccgacgagaagatgaacgaggtgatggacttagcccacacc
ttcctgcagaacttctgccgtgggaatccgcagaaccaagttctccttcacaagcatctc
aatctgttcctaactcctggcctcctggaggcagaaaccatgcggcacatcttcatgaac
aattatcacctgtgcaacgagatcagcgagagggtggtccagcacttcgtgcactgcatt
gagacacatggccgccatgtggagtacctgaggttcctgcagacgatcgtgaaagcagat
ggcaaatacgtgaagaaatgccaggacatggtgatgacggagttgatcaatgggggcgag
gatgtgttgatattctacaatgacagagcttcatttcccatcctcctcaacatgatgtgc
tctgagagagcccgtggggacgagagcggccccctcgcctaccacatcacccttgtggag
ttgctggcagcgtgcaccgaaggcaaaaatgtctacacagaaatcaagtgcaattctctc
ttgcctctggacgacatagtgagagtggtgacccacgatgactgcattcctgaggtcaaa
atcgcgtacgtgaactttgtcaaccattgctacgttgacactgaagtggagatgaaggag
atctacacaagtaaccacatttggaagttatttgagaatttcttggtggatatggcgagg
gtctgtaacaccaccacagacaggaaacacgcagacacctttctggagaggtgtgtgaca
gagtcagtcatgaacattgtgagcggcttcttcaactcgccattttccgacaacagtacc
agcctccagacccaccagccagtctttatccagctgctgcagtctgccttcagaatttac
aactgtacctggcccaacccagcccagaaagcctccgtagaatcctgtatcagagccctg
gctgaagtggccaaaaaccgtgggattgcgatcccagtcgatttggacagccaggtcaac
acgctcttcatgaagaaccactcaagtacggtgcagagggcagccatgggctggagactc
tcagctcgctctggacctcgcttcaaggaagctcttggaggaccagcctgggattacaga
aatattattgaaaagttacaggatgtcgtggcctccctggaacagcagttcagccccatg
atgcaggccgagttctctgtgcttgtggatgtgctgtacagcccggagctactgttccca
gagggaagcgacgccaggatccgatgtggtgccttcatgtccaagctgattaatcacaca
aagaaactgatggagaaagaagaaaagctgtgcattaaaatcctccagactttacgggag
atgctggagaagaaagacagcttcatggaagagggtagcacattacggcgaatcctcctg
aatcggtacttcaagggtgatcatagcattagtgtgaacggacctctgtcaggagcctat
gccaagacagcacaagtgggaggaagcttctctggacaggattcagataagaagggcatt
tcaatgtccgatatccagtgtttgctggacaaagaaggagcatccgaacttgtcatcgat
gtcattgtgaacaccaaaaacgacaggatcttttccgaaggaattttgcttggcattgcc
ttgctggaaggaggaaacacacagacccagtattctttctaccagcagttgcatgaacaa
aaaaagtcagagaaatttttcaaagtcctttatgatcggatgaaggctgctcagaaagag
atcagatccacggtgaccgtcaacaccatagacttagggagcaagaagagagaagaggac
agtgacgtcatggccctgggccctcggatgagagtgagagactcatcactacatttgaga
gaaggaatgaaagggcagttaacagaagcgtcttcagccacatccaaagcatactgtgtg
tacagaagagagatggacccggaaatagacacaatgtgcccgggacaggaagcaggaagt
gcggaggaaaagtctgcggaggaagttaccatgagcccggccatcaccatcatgcgtccc
atcctcaggttcctgcagttactgtgtgagaatcataaccgggagcttcagaacttcttg
aggaaccagaacaacaaaacaaactacaaccttgtctgtgaaacgcttcagttcctggac
tgtatctgcggaagtaccacagggggtctaggcctgctggggctctacatcaatgagagg
aatgtagctctggtcaaccagactctggagagcttgaccgagtactgccaaggcccgtgc
cacgagaaccagacctgtatcgccactcacgaatccaatgggattgatatcatcatcgcc
ttgattctgaatgacatcaaccccctgggcaagtacagaatggacttggtgttgcagctg
aagaacaacgcctccaagcttctgctggccattatggagagcagacatgacagtgagaat
gcagagagaattcttttcaacatgagacccagggaactggtggatgtcatgaagaatgcc
tataaccaaggcctggaatgtgaccatggggacgaggagggaggggatgatggtgtttct
ccaaaagacgttggacacaacatctacattctggcccatcagttggcccgccacaacaaa
ctgctgcagcagatgctcaagccgggatctgacccagaggaaggggatgaagctttgaag
tattacgccaaccacaccgcgcagatcgagattgtgcggcatgaccggactatggagcag
attgttttcccggtccccaacatctgtgaattcctcactcgggaatccaagtaccgagtg
ttcaacacaacggagagggatgagcaaggaagcaaggtgaacgacttcttccagcaaacg
gaagatctctacaacgagatgaaatggcaaaagaagatcagaaacaaccccgccctgttc
tggttctccaggcacatctcactctgggggagcatctccttcaacctggctgtgttcatc
aacctggctgtggctctcttctacccattcggggatgacggtgatgaaggcacactctcc
ccgatgttctcagtcctcctttgggtagcagtggcgatctgcacatctatgctgttcttc
ttctccaagcccgtgggcatccggccattcctcgtgtctgtcatgctcagatcgatatac
accatcggtctggggccaacgctaatactacttggtgctgccaatctatgtaataaaatc
gtgttcctggtgagttttgtgggaaaccgaggcacattcaccagaggctaccgagcagtc
attctggacatggcctttctttaccacgtggcctatgtcctggtttgcatgcttggcctc
tttgtccacgagttcttctacagcttcctgctttttgatttggtatatagagaagagacc
ctgctgaatgtcatcaaaagcgtcacacggaacggccgctccatcatcctgaccgcggtc
ttggctcttatcttggtctacctgttctccatcatcggcttccttttcttaaaggacgac
ttcaccatggaggtggacagactgaaaaacagaactccagtcacaggtaatcacggggtt
cccactatgaccttatcttccatgatggaaacctgccagaaggaaaactgctcacccacg
atcccctcttccaacacagccggcgaggaaggtgaggatggcatagaaaggacatgtgat
accctgctcatgtgcattgtcaccgtgctgaaccagggcctcaggaatggcggcggagtt
ggggatgtgctgagacgaccctcgaaagatgagcccttgtttgctgcccgggtagtctac
gacctcctgttcttcttcatcgtcatcatcatcgttctcaacctgatctttggagtgatc
attgacacgtttgctgacctcagaagtgagaagcagaagaaagaagaaatcctcaagaca
acctgcttcatctgtggcctggagagagacaagtttgataacaagacagtgtcctttgag
gagcacatcaagtcagagcacaacatgtggcattacctgtacttcatcgtcctggtgaag
gtgaaggacccgacagaatacacagggcctgagagctacgtggctcagatgatcacggag
aagaatttggactggtttcctcggatgcgagccatgtcacttgtcagcaacgaaggtgac
agtgagcaaaatgagatccggaacctgcaggagaagctggagtctacgatgagtctggtg
aagcagctgtcagggcagctggcagagctgaaggagcagatgacagaacaaaggaaaaac
aagcaaaggctgggctttcttggatcaaacacaccccatgtgaaccatcacatgccaccg
cactga

DBGET integrated database retrieval system