KEGG   Mus musculus (mouse): 16490Help
Entry
16490             CDS       T01002                                 

Gene name
Kcna2, Akr6a4, Gm10672, Kca1-2, Kv1.2, Mk-2
Definition
(RefSeq) potassium voltage-gated channel, shaker-related subfamily, member 2
  KO
K04875  
potassium voltage-gated channel Shaker-related subfamily A member 2
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCNA, Kv1.x (Shaker)
   16490 (Kcna2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 F2.3; 3 46.61 cM
AA seq 499 aa AA seqDB search
MTVATGDPVDEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG
DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE
EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF
CLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR
FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR
VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPS
IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE
TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTA
NCTLANTNYVNITKMLTDV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggctaccggagacccagtggacgaggctgctgccctccctgggcacccacaa
gacacctatgacccagaggcagaccatgaatgctgtgagagagtggtcatcaacatctca
ggcctgcggttcgaaactcagctaaagaccttagcccagttcccagagaccctcttaggg
gaccccaagaaacggatgaggtacttcgatcccctccgaaatgagtacttttttgatcgc
aaccgccctagctttgatgccattttgtactactatcagtctgggggcaggttgaggcga
cctgtgaacgtgcccttagatatcttctcggaagaaatccggttttatgagctaggagaa
gaagcaatggagatgtttcgggaggatgaaggctacatcaaggaagaagagcgtcctctg
cctgaaaatgagtttcagagacaggtgtggcttctctttgaataccctgagagctcaggg
cctgccaggattatagccattgtatctgtgatggtcattctgatctccatcgtcagcttc
tgtctggaaaccttgcccatcttccgggatgagaatgaggacatgcatggtggcggggtg
accttccacacctattccaacagcaccatcgggtaccagcagtccacctccttcaccgac
cctttcttcattgtagagactctctgcatcatctggttctcctttgagtttctggttaga
ttctttgcctgtcccagcaaagctggcttcttcaccaacatcatgaacatcattgacatt
gtggctatcatcccttactttatcaccctggggacagagttagctgagaagccagaggac
gcccagcaaggccagcaggccatgtcactggccattctccgtgtcatccggttggtaaga
gtctttaggattttcaagttgtccagacactccaaaggtctacagattctaggtcagacc
ctcaaagctagcatgagggaattgggcctcctgatattcttcctcttcattggggtcatc
ctcttctctagtgctgtctattttgcagaagctgatgagagagattcccagttccccagc
atcccggatgctttctggtgggcagtcgtctccatgacaactgtaggctatggagacatg
gttccaactaccattggggggaagatagtgggttctctgtgtgcaattgcaggtgtgtta
accattgccttaccagtccctgtcatagtgtctaatttcaactacttctaccaccgggag
acagagggagaggagcaggcccagtacttgcaagtgacaagctgtccaaagatcccgtcc
tcccctgacctaaagaaaagtagaagtgcctctaccataagtaagtctgattacatggag
atacaggagggagttaacaacagcaatgaggactttagagaggagaacttaaaaacagcc
aactgtaccttggctaacacaaactatgtgaatattaccaaaatgttaactgatgtctga

DBGET integrated database retrieval system