KEGG   Mus musculus (mouse): 16494Help
Entry
16494             CDS       T01002                                 

Gene name
Kcna6, Kv1.6, MK1.6
Definition
(RefSeq) potassium voltage-gated channel, shaker-related, subfamily, member 6
  KO
K04879  
potassium voltage-gated channel Shaker-related subfamily A member 6
Organism
mmu  Mus musculus (mouse)
Brite
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     16494 (Kcna6)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCNA, Kv1.x (Shaker)
   16494 (Kcna6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 F3; 6 61.72 cM
AA seq 529 aa AA seqDB search
MRSEKSLTLAAPGEVRGPEGEQQDAGEFQEAEGGGGCCSSERLVINISGLRFETQLRTLS
LFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFMEE
IRFYQLGEEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPQFRADGRGGSNEGSGTRLSPASRSHEEEDEDEDSYAFPGSIPS
GGLGTGGTSSLSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKAAFFRNIMNIID
LVAIFPYFITLGTELVQRHEQQSVSGGSGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSK
GLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDVDSLFPSIPDAFWWAVVTM
TTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHV
TCGQPTPDLKATDNGLGKPDFAEASRERRPSYLPTPHRAYAEKRMLTEV
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgagatcggagaaatccctgacgctggcggcgccgggggaggtccgtgggccggagggg
gagcaacaggatgcgggtgagttccaggaggccgagggcggcggcggctgctgtagtagt
gagaggttggtgatcaacatctccgggctgcgcttcgagacgcagctgcgcaccctgtcg
ctgttccctgacacgctgctaggagaccctggccgcagagtccgtttctttgaccccttg
aggaacgagtacttctttgaccgcaaccgacccagcttcgacgctatcctttattactat
caatctggaggtcgcctgcgcaggcctgttaatgtgcccctggacatttttatggaagag
atccgcttctatcagttgggagaggaagccctggcggccttccgggaggatgagggttgc
ctgcccgaaggtggcgaggatgagaaaccactcccctcccagcctttccagcgacaggtc
tggcttctctttgagtacccggagagttccgggcccgcccgaggcatcgccatcgtctca
gtattggtcatcctcatctccatcgtcatcttttgcctggagaccttgcctcaattccgt
gcagatgggcgcggtggaagcaacgagggtagtgggacccgcttgtctccggcctccagg
agccacgaggaagaagatgaggatgaagattcctatgcatttcctggtagcattccctct
ggggggttggggactggaggaacatcttcacttagtactctcgggggttctttcttcaca
gaccccttcttcttggtggaaactctgtgtatcgtctggttcacgtttgagctcctggtg
cgcttctctgcctgtcccagcaaggcggccttctttcgcaatatcatgaacatcattgac
ttggtggccattttcccctactttatcaccttgggcaccgagctagtgcaacgtcacgag
cagcagtctgtgagtggtggcagtggtcagaatgggcagcaggccatgtccctagccatc
ctcagggtgatccgcctggtccgggtgttccgaatcttcaagctctcccgccattccaag
gggctgcagatcctgggtaagaccttacaggcgtccatgcgggagctcgggctgctcatc
ttcttcctcttcatcggagtcatcctcttttccagcgctgtctacttcgcagaggctgat
gatgttgactcgctcttccctagcatcccagatgccttctggtgggctgtggttacaatg
accacggtaggttatggggacatgtaccccatgacggtagggggcaagattgtgggctca
ctgtgcgccattgctggggtcctcaccattgcattaccggtaccggtcattgtctccaat
ttcaactacttctaccaccgagagacggagcaggaggagcaaggccagtatacccacgtc
acttgtgggcagcccactccggacttgaaggcaacggacaatgggcttggcaaacctgac
tttgccgaggcttcacgggaacgccggcccagctaccttccgactccacatcgagcttat
gcggagaaaaggatgctcaccgaggtttga

DBGET integrated database retrieval system