KEGG   Mus musculus (mouse): 16506Help
Entry
16506             CDS       T01002                                 

Gene name
Kcnd1, 1110037K09Rik, Kca2-1, Kv4.1, Shal, Shal1, mShal1
Definition
(RefSeq) potassium voltage-gated channel, Shal-related family, member 1
  KO
K04891  
potassium voltage-gated channel Shal-related subfamily D member 1
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCND, Kv4.x (Shal)
   16506 (Kcnd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
X A1.1; X 3.53 cM
AA seq 651 aa AA seqDB search
MAAGVATWLPFARAAAVGWLPLAQQPLPPAPEVKASRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDAESGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGEGPALPAGSSLRQRLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRGTPRWPSKEQSCGDRFPTAFFCMDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLFVPKNDDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTSKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGDGQMLCVRSRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSEALGAVSLGGRTSRSTSVSSQPMGPGSLFSSCCSRRVNRR
AIRLANSTASVSRGSMQELDTLAGLRRSPAPQTRSSLNAKPHDSLDLNCDSRDFVAAIIS
IPTPPANTPDESQPSSPSGGGGSGGTPNTTLRNSSLGTPCLLPETVKISSL
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaggtgtggccacatggctaccatttgcaagggccgcagcagtgggctggctg
cccttagcccagcagcccctaccccctgcaccggaggtgaaggcatcccgaggggatgag
gttctggtggtgaatgtgagtggtcggcgctttgagacctggaaaaacacactggatcgc
tacccagacacattgctgggcagctcggagaaggaattcttctatgatgctgaatctggc
gagtacttctttgatcgtgacccagacatgttccggcacgtgctgaacttttatcgcact
ggccggctgcactgccccaggcaggagtgcatccaggcctttgatgaggagctggccttc
tatggcttggtcccagagctggttggtgactgctgtcttgaagagtacagggaccgtaag
aaggaaaacgcagagcgcctggcagaagatgaggaggctgagcaggccggggaaggtcca
gcccttccagcaggcagctccctgcgacagcgactctggagggcctttgagaacccccac
acgagcactgcagccctggttttctactatgtgactggcttcttcatagctgtgtcagtc
attgccaacgtcgtggagaccatcccatgtcgtggtaccccacgatggccctccaaagag
cagtcgtgtggtgaccgcttccctacagcctttttctgtatggacacagcctgtgtactc
atattcacaggggagtacctgctgcggctcttcgcagcccccagccgttgtcgcttcctg
cggagtgtgatgagccttatcgatgtggtggccatcctaccctactatattgggctgttc
gtgcccaagaatgatgatgtctctggtgcctttgtcaccctccgtgtgttccgggtcttc
cgaatcttcaagttctccaggcactcgcagggcctgaggattctgggctacaccctcaag
agctgtgcctctgagctaggctttctcctcttttccctcaccatggccatcatcatcttt
gccactgtcatgttctatgctgagaagggcacgagcaagaccaacttcacaagcatccct
gctgccttctggtataccattgtcaccatgaccacacttgggtatggagatatggtacct
agcaccattgcaggcaaaatttttgggtccatctgctcacttagcggtgtcttggtcatt
gccttgcctgtgccagtcattgtatccaacttcagccgcatctaccaccagaaccagcgt
gctgacaagcgccgggcacagcagaaagtgcgcctggcaagaatccgtttggcaaagagt
ggtaccaccaatgccttcctgcagtataagcaaaatgggggcctcgaggacagtggcagt
ggcgacggacaaatgctgtgcgttaggagccgctctgcttttgaacaacagcatcaccat
ctgctgcattgtctggagaagactacgtgtcacgagttcacagacgagctaactttcagt
gaggcccttggagcagtctcactgggtggtcgcaccagccgcagtacctcagtatcatcc
caaccaatggggcctgggagcctgttctcatcctgctgctctcgaagggtcaatcgcaga
gccatccgccttgccaactctactgcctctgtcagccgtggcagcatgcaggagctagac
acactagcaggtcttcggaggagccctgcccctcaaacccgctcaagcctcaatgccaag
ccccacgacagccttgacctgaactgtgacagccgggacttcgtggccgccatcatcagt
atccccaccccccctgccaacacgccagatgaaagtcaaccttcctcccctagtggtggt
ggcggcagtggtggcacacccaacaccactctcaggaactccagcttgggtactccgtgc
ctcctccctgagactgtcaagatctcttccctgtga

DBGET integrated database retrieval system