KEGG   Mus musculus (mouse): 16508Help
Entry
16508             CDS       T01002                                 

Gene name
Kcnd2, AI839615, AW555701, Kv4.2, R75121, mKIAA1044
Definition
(RefSeq) potassium voltage-gated channel, Shal-related family, member 2
  KO
K04892  
potassium voltage-gated channel Shal-related subfamily D member 2
Organism
mmu  Mus musculus (mouse)
Pathway
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    16508 (Kcnd2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCND, Kv4.x (Shal)
   16508 (Kcnd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 A2-A3.1; 6 8.49 cM
AA seq 630 aa AA seqDB search
MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE
RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA
FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDNTGESALPTMTARQRVWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF
TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA
FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEPAFISKSGSSFETQHHH
LLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRI
PNANVSGSHRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI
PTPPVTTPEGDDRPESPEYSGGNIVRVSAL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcagccggtgttgcagcatggctgccctttgccagggcagccgccattgggtggatg
cctgttgcttcggggcctatgcctgcgcccccaagacaggagagaaaaaggactcaggac
gctctgatagtgctgaacgtgagtggcacccgtttccagacatggcaagacaccctggaa
cgatacccagacactctgctgggtagttctgagagagactttttctaccacccagagacc
caacaatacttctttgaccgtgacccggacatcttccgccacatcctcaacttctaccgc
acggggaagcttcactatccccgccatgagtgcatctcggcttatgatgaagaactggcc
ttctttggcctcatcccagaaattattggcgactgctgttatgaggagtacaaggaccgc
aggcgggagaatgctgagcgcctccaggatgatgcagacactgacaatacaggagagagt
gcgctgcccaccatgactgctaggcagagggtctggcgggcctttgagaatccccacacc
agcaccatggccctggtgttctactatgtgactgggttcttcattgccgtctcagtcatc
gcgaatgtggtggaaacagttccatgtgggtctagcccaggccacataaaagaactgcct
tgtggggagaggtatgcggtggccttcttctgcttggataccgcctgtgtcatgatcttc
acagttgagtacttgcttcgcctggccgcagcacctagtcgttaccgtttcgtgcgcagt
gtcatgagtatcatcgacgtggtggccatcctaccctattacattgggctggtgatgaca
gacaatgaggatgtcagtggagcctttgtcacactccgagtctttcgagtcttcaggatc
tttaagttttcccgccactctcaagggctgcgtatactggggtacaccctgaagagctgt
gcatcagaactgggcttcttgctcttttctctcacaatggctatcatcattttcgctacc
gttatgttctacgcagagaagggctcttcagcaagcaagttcaccagcatcccggcagcc
ttctggtacaccatcgtcaccatgacaacactggggtatggcgacatggtaccaaaaacc
atagcagggaagatttttgggtccatctgctcactgagcggagtcttggtcattgcgcta
cccgtgcctgtgatcgtgtcgaacttcagtcggatctaccaccaaaaccaacgagcagac
aaacgaagggcacagaagaaagccaggctggccaggatccgagcagccaaaagcgggagt
gcaaatgcctacatgcagagcaagcggaatgggctactgagcaaccagctgcagtcctcg
gaggatgaaccggccttcataagcaaatctggatccagctttgagacacagcaccaccac
ctgcttcactgcctggagaaaaccacgaaccatgagtttgtcgatgaacaagtctttgaa
gaaagctgcatggaagttgccaccgtcaatcgcccatcaagtcacagtccctctctctcc
tcacaacaaggagtcaccagcacttgctgctcacggagacacaaaaagactttccgcatt
cctaatgccaatgtgtcgggaagccatagaggcagtgtgcaagaactcagtacaattcag
atcagatgtgtggagagaactccactatccaacagccgatccagcttaaatgccaaaatg
gaagagtgtgttaaactaaactgtgaacaaccttacgtgaccacagcaataataagcatc
ccaacacctccagtaaccaccccagaaggcgacgacaggcccgagtctcctgagtattcg
ggaggaaatatcgtcagggtgtctgccttgtaa

DBGET integrated database retrieval system