KEGG   Mus musculus (mouse): 16513Help
Entry
16513             CDS       T01002                                 

Gene name
Kcnj10, BIR10, BIRK-1, Kir1.2, Kir4.1
Definition
(RefSeq) potassium inwardly-rectifying channel, subfamily J, member 10
  KO
K05003  
potassium inwardly-rectifying channel subfamily J member 10
Organism
mmu  Mus musculus (mouse)
Pathway
Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    16513 (Kcnj10)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   16513 (Kcnj10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 H3; 1 79.69 cM
AA seq 379 aa AA seqDB search
MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEES
LREQAEKEGSALSVRISNV
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcggtcgctaaggtctattacagtcagacgactcagacagagagccgcccccta
gtggccccaggaatacgccggaggagggtcctcacgaaagacggccggagcaatgtgaga
atggagcacattgctgacaaacgtttcctctacctcaaggatctatggacgaccttcatt
gacatgcaatggcgctacaagcttctgctcttctctgcaacctttgcaggcacgtggttc
ctctttggtgtggtgtggtatctggtagctgtggcccatggggacctgttggagctggga
cctcctgccaaccacacgccttgtgtggtgcaggtgcacacgctcaccggagccttcctc
ttctccctggaatcccagaccaccatcggctatggcttccgctacatcagtgaggaatgc
ccactggccatcgtgcttcttattgcgcagctggtgctcaccaccattctggaaatcttc
atcacaggtaccttccttgcaaagattgcccggcctaagaagagggccgagacgatccgc
ttcagccagcatgccgttgtggcttcccataacgggaagccttgccttatgatccgggtt
gccaatatgcggaagagtctcctcattggatgccaggtgacaggcaaactgcttcaaacg
caccagacaaaggagggtgagaatattcggctcaaccaggtcaacgtgactttccaagta
gacacagcctcagacagcccctttctcatcctacccctgactttctaccacgtggtagat
gagaccagccccttaaaagatctcccgctccgcagtggggagggggactttgagctggtg
ctgatcctgagtgggacagtggagtccaccagtgccacctgccaagttcgcacttcctac
ctaccggaggagatcctctggggttacgagttcacgcctgcgatctcactgtcagccagt
ggcaaatacatagctgacttcagccttttcgaccaggttgtgaaagtggcatctcccagt
ggtctccgcgatagcaccgtacgctatggagaccccgagaagctcaagttggaggagtca
ttaagagagcaagctgaaaaggaaggcagtgcccttagtgtgcgcatcagcaacgtctga

DBGET integrated database retrieval system