KEGG   Mus musculus (mouse): 16516Help
Entry
16516             CDS       T01002                                 

Gene name
Kcnj15, 4930414N08Rik, AI182284, AI267127, IRKK, Kir4.2
Definition
(RefSeq) potassium inwardly-rectifying channel, subfamily J, member 15
  KO
K05008  
potassium inwardly-rectifying channel subfamily J member 15
Organism
mmu  Mus musculus (mouse)
Pathway
Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    16516 (Kcnj15)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   16516 (Kcnj15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16 C4; 16 55.86 cM
AA seq 375 aa AA seqDB search
MDAIHLGMSSAPLVKHTNGVGLKAHRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVVYYAIAFIHGDLQLGESNSNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVISKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSY
IPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQKLEEQYRQEDQ
RERELRSLLLQQSNV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgccattcaccttggcatgtccagtgccccactggtgaagcataccaacggggtt
ggactcaaggcccacagaccccgagtcatgtcaaagagtgggcacagtaatgtgagaatc
gataaggtagacggaatctatttactctacctccaggacttgtggacaaccgtcatcgac
atgaagtggcgatacaagctcaccctatttgctgccacctttgtgatgacctggtttctg
tttggagtggtctactatgccatagcctttattcatggtgacttacaacttggggaatct
aattccaaccacacaccctgcattatgaaagtggactctctcacaggagcattcctcttt
tccttggaatctcagacaaccattggctacggggtccgttccatcacagaggagtgtccc
catgctatcttcctcttagtcgcccaactggtcatcaccacattgattgagatcttcatt
acggggacctttctggctaaaattgcaagacccaaaaagcgagccgagaccattaagttc
agccactgtgctgtcatcagcaagcagaatggaaagctatgcctggtcatccaggtggcc
aacatgaggaagagtctcctgattcagtgccagctctctggaaaactcctgcagacacac
gtcaccaaagagggagaacgcattctcctcaaccaggccactgtcaaattccacgtggac
tcctcttccgagagtcccttcctcatcctgcccatgaccttctaccacgtgttggatgag
acaagccccctgcgggacctcacaccccaaaacctaaaggagaaggagtttgagctggtg
gtacttctcaacgccacggtggagtctaccagcgccgtctgccagagccgaacgtcttac
atcccggaggagatctactggggctttgagtttgtgcctgtggtttctctctccaaaaat
ggaaagtatgtggctgatttcagtcaatttgagcagatcaggaagagcccggattgtacc
ttctactgtgccgattctgagaagcagaagcttgaagaacagtacaggcaagaggaccag
agggagcgggagctgaggagcctcctgctacagcagagcaatgtctga

DBGET integrated database retrieval system