KEGG   Mus musculus (mouse): 16516Help
Entry
16516             CDS       T01002                                 

Gene name
Kcnj15, 4930414N08Rik, AI182284, AI267127, IRKK, Kir4.2
Definition
(RefSeq) potassium inwardly-rectifying channel, subfamily J, member 15
  KO
K05008  potassium inwardly-rectifying channel subfamily J member 15
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    16516 (Kcnj15)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   16516 (Kcnj15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK Ion_trans_2 DUF2182
Motif
Other DBs
NCBI-GeneID: 16516
NCBI-ProteinID: NP_001034145
MGI: 1310000
Ensembl: ENSMUSG00000062609
Vega: OTTMUSG00000019964
UniProt: O88932 Q53Z04
Position
16 C4; 16 55.86 cM
AA seq 375 aa AA seqDB search
MDAIHLGMSSAPLVKHTNGVGLKAHRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVVYYAIAFIHGDLQLGESNSNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVISKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSY
IPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQKLEEQYRQEDQ
RERELRSLLLQQSNV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgccattcaccttggcatgtccagtgccccactggtgaagcataccaacggggtt
ggactcaaggcccacagaccccgagtcatgtcaaagagtgggcacagtaatgtgagaatc
gataaggtagacggaatctatttactctacctccaggacttgtggacaaccgtcatcgac
atgaagtggcgatacaagctcaccctatttgctgccacctttgtgatgacctggtttctg
tttggagtggtctactatgccatagcctttattcatggtgacttacaacttggggaatct
aattccaaccacacaccctgcattatgaaagtggactctctcacaggagcattcctcttt
tccttggaatctcagacaaccattggctacggggtccgttccatcacagaggagtgtccc
catgctatcttcctcttagtcgcccaactggtcatcaccacattgattgagatcttcatt
acggggacctttctggctaaaattgcaagacccaaaaagcgagccgagaccattaagttc
agccactgtgctgtcatcagcaagcagaatggaaagctatgcctggtcatccaggtggcc
aacatgaggaagagtctcctgattcagtgccagctctctggaaaactcctgcagacacac
gtcaccaaagagggagaacgcattctcctcaaccaggccactgtcaaattccacgtggac
tcctcttccgagagtcccttcctcatcctgcccatgaccttctaccacgtgttggatgag
acaagccccctgcgggacctcacaccccaaaacctaaaggagaaggagtttgagctggtg
gtacttctcaacgccacggtggagtctaccagcgccgtctgccagagccgaacgtcttac
atcccggaggagatctactggggctttgagtttgtgcctgtggtttctctctccaaaaat
ggaaagtatgtggctgatttcagtcaatttgagcagatcaggaagagcccggattgtacc
ttctactgtgccgattctgagaagcagaagcttgaagaacagtacaggcaagaggaccag
agggagcgggagctgaggagcctcctgctacagcagagcaatgtctga

DBGET integrated database retrieval system