KEGG   Mus musculus (mouse): 16517Help
Entry
16517             CDS       T01002                                 

Gene name
Kcnj16, 6430410F18Rik, AI132396, Kir5.1
Definition
(RefSeq) potassium inwardly-rectifying channel, subfamily J, member 16
  KO
K05009  
potassium inwardly-rectifying channel subfamily J member 16
Organism
mmu  Mus musculus (mouse)
Pathway
Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    16517 (Kcnj16)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   16517 (Kcnj16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 E2; 11 75.01 cM
AA seq 419 aa AA seqDB search
MSYYGSSYRIVNVDSKYPGYPPEHAIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYMVD
IFTTLVDTKWRHMFVIFSLSYILSWLIFGSIFWLIAFHHGDLLSDPDITPCVDNVHSFTA
AFLFSLETQTTIGYGYRCVTEECSVAVLTVILQSILSCIINTFIIGAALAKMATARKRAQ
TIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYSEDSEGRMTMAFKDLKL
VNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYI
PREILWGHRFHDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLNNLEKTSPA
RGSCNSDTNTRRRSFSAVAVVSSCENPEETVLSPQDECKEMPYQKALLTLNRISMESQM
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagctattacggaagtagctacaggatcgtcaatgtggactccaaatatccaggctat
cctccagagcatgccatcgctgagaagagaagagcaagaaggcgcttgctccacaaagat
ggcagctgtaatgtgtactttaaacacatttttggagaatgggggagctacatggttgat
atttttaccactcttgtggataccaagtggcgccatatgttcgtaatattttctctgtct
tacattctctcctggttgatatttggctccatattttggctcatagcctttcatcacgga
gacctattaagcgatccagatatcaccccttgtgttgacaacgtgcattcatttacggct
gcatttttattctccctggagacccagaccaccattggatacggttaccgctgtgtcacc
gaagagtgctctgtggctgtactgacagtgatccttcagtccatcctcagctgcatcata
aacaccttcatcattggagcagccttggcaaagatggcaactgcccggaagagagcccag
accatacgcttcagctattttgccctcattggtatgagagacgggaagctttgcctcatg
tggcgcataggtgacttccgaccaaaccatgtggtagagggcacggtgagagcccaactt
ctgcgctattcagaagacagtgaagggaggatgacgatggcgtttaaagacctcaaactc
gtcaatgaccagataatcctggtaactccagtgactattgtccatgaaattgaccatgag
agccctctgtatgcccttgaccgcaaggcagtggccaaagataatttcgagattctggtg
acatttatttatactggtgattccactgggacatcccaccagtccagaagttcctacatc
cccagagaaattctctggggccacaggtttcatgatgtattggaagtgaagagaaagtac
tacaaggtgaactgcttgcagtttgaaggaagcgtggaagtctacgcccccttttgcagt
gccaaacaactggactggaaggaccaacaactcaacaacttggagaaaacgtcccctgcc
cgaggatcctgcaattctgacaccaacaccaggaggcggtccttcagcgcagttgccgtg
gtgagcagctgtgagaacccagaggagaccgtcctgtccccacaagatgaatgtaaggag
atgccctatcagaaagccctcctgactttaaataggatctccatggaatcccagatgtag

DBGET integrated database retrieval system