KEGG   Mus musculus (mouse): 16518Help
Entry
16518             CDS       T01002                                 

Gene name
Kcnj2, IRK1, Kcnf1, Kir2.1
Definition
(RefSeq) potassium inwardly-rectifying channel, subfamily J, member 2
  KO
K04996  
potassium inwardly-rectifying channel subfamily J member 2
Organism
mmu  Mus musculus (mouse)
Pathway
Cholinergic synapse
Oxytocin signaling pathway
Renin secretion
Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    16518 (Kcnj2)
   04924 Renin secretion
    16518 (Kcnj2)
  Digestive system
   04971 Gastric acid secretion
    16518 (Kcnj2)
  Nervous system
   04725 Cholinergic synapse
    16518 (Kcnj2)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   16518 (Kcnj2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11 E2; 11 75.23 cM
AA seq 428 aa AA seqDB search
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDTSKVSK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALTSKEEEEDSENGVPESTSTDSPPGIDLHNQASVPLEPR
PLRRESEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtgtgagaaccaaccgctacagcatcgtctcttcggaggaagatggcatgaag
ctggccactatggcagttgccaatggctttgggaatggcaagagtaaagtccatacccga
caacagtgcaggagccgctttgtgaagaaagatggtcattgcaatgttcagtttatcaac
gtgggtgagaagggacagaggtacctggcagacatctttactacctgtgtcgacatccgc
tggaggtggatgctggttatcttctgtcttgccttcgtgctctcctggctgttctttggc
tgtgtgttttggttgatagccctgctccatggggatctagatacttctaaagtgagcaaa
gcatgcgtgtcagaggtcaacagcttcacggctgccttcctcttctccatcgagacccag
acaaccattggctatggtttcaggtgtgtgacagacgagtgcccaattgctgtcttcatg
gtggtattccagtcaatcgtaggctgcatcattgacgccttcatcattggtgcagtcatg
gcgaagatggcaaagccaaagaagagaaatgagactcttgtcttcagtcacaatgctgtg
attgccatgagggatggcaaactctgcttgatgtggagagtgggtaaccttcgaaagagc
caccttgtggaagctcatgtccgggcacagcttctcaaatctaggatcacttcagaaggg
gagtatatccctttggaccagatagacatcaatgttggttttgatagtggaattgaccgc
atatttctagtgtcccccatcactatcgttcacgaaatagatgaagacagccctttatat
gacttgagtaagcaggacattgacaatgcagactttgaaattgttgtcatactggaaggc
atggtggaggcgactgccatgacaactcaatgccggagttcgtatctggccaatgaaatt
ctctggggtcaccgctatgagccagtgctctttgaagagaaacactactataaagtagac
tattcaagattccataagacttatgaagtacctaacacccccctttgtagtgccagagac
ttagcagagaagaaatacatcctttcaaatgcaaattcattttgctatgaaaatgaagtt
gccctaacaagcaaagaggaagaggaggatagtgagaacggagtcccagagagcacaagc
acagactcacctcctggcatagatctccacaaccaggcaagcgtacctctagagcccagg
cccttaaggcgagaatcggagatatga

DBGET integrated database retrieval system