KEGG   Mus musculus (mouse): 16523Help
Entry
16523             CDS       T01002                                 

Gene name
Kcnj8, AI448900, Kir6.1, gnite, slmbr, sltr
Definition
(RefSeq) potassium inwardly-rectifying channel, subfamily J, member 8
  KO
K05001  
potassium inwardly-rectifying channel subfamily J member 8
Organism
mmu  Mus musculus (mouse)
Pathway
cGMP-PKG signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    16523 (Kcnj8)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   16523 (Kcnj8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 G2; 6 74.31 cM
AA seq 424 aa AA seqDB search
MLARKSIIPEEYVLARIAAENLRKPRIRDRLPKARFIAKSGACNLAHKNIREQGRFLQDI
FTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWWLVAFAHGDIYAYMEKGTMEKSGLESAVC
VTNVRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMK
TAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQVVKKTTTPEGEV
VPIHQQDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDISATDLANQDLEVIVILEGVV
ETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVRVAAPRCSARELDE
KPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQC
PSES
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgttggccaggaagagcatcatcccggaggagtatgtgctggcgcgcatcgcagcggag
aacctgcgcaaaccgcgcatccgcgaccgtctccccaaagcccgcttcatcgccaagagc
ggagcctgcaacctggcacacaagaacatccgagagcaaggtcgcttcctgcaggacatc
ttcaccaccttggtagacctgaagtggcgtcacacgctggtcatcttcaccatgtccttc
ctctgcagctggctgctcttcgctatcatgtggtggctggtggccttcgcccacggggac
atctatgcttacatggagaaaggcaccatggagaagagtggcctggagtccgctgtctgt
gtgaccaatgtcaggtcattcacgtctgcgtttctcttctccattgaggttcaagtgacc
attgggtttggagggagaatgatgactgaggaatgccctctggccatcacggttttgatt
ctgcagaacatcgtgggtctgatcatcaacgcagtcatgttgggctgcatcttcatgaag
acggcgcaggcccacagaagggcagagacgctgattttcagccgccatgctgtgattgcc
gtccgcaatggcaagctgtgcttcatgttccgggtgggtgacctgaggaagagcatgatc
attagcgcctcggtgcgcatccaggtggtcaagaaaaccacgacgccagaaggggaggtg
gtgcctattcatcagcaggacattcctgttgataatcccatcgagagcaataatatcttc
ctagtggccccattgatcatctgccacgtgattgacaagcgtagccccctgtatgatatc
tcagcaactgaccttgccaatcaagacctggaggtcatagtgattctcgagggcgtggta
gaaaccacaggcatcaccacacaagcacggacctcctacattgccgaggagatccagtgg
ggacaccgcttcgtgtcaattgtgactgaggaggagggcgtgtactctgtggactattcc
aaatttggtaacacggtgagagtggctgcgccaagatgcagtgcccgggagctggatgag
aagccttccatcctgattcagaccctccaaaagagcgaactgtcgcaccagaattctctg
cggaagcgcaactccatgaggagaaacaactccatgaggagaaacaactccatcaggagg
aataactcttccctcatggtgcccaaggtgcagttcatgactccagaaggaaaccagtgt
ccatcagaatcatga

DBGET integrated database retrieval system