KEGG   Mus musculus (mouse): 16524Help
Entry
16524             CDS       T01002                                 

Gene name
Kcnj9, 1700085N21Rik, Girk3, Kir3.3, mbGIRK3
Definition
(RefSeq) potassium inwardly-rectifying channel, subfamily J, member 9
  KO
K05002  potassium inwardly-rectifying channel subfamily J member 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04713  Circadian entrainment
mmu04723  Retrograde endocannabinoid signaling
mmu04726  Serotonergic synapse
mmu04728  Dopaminergic synapse
mmu04915  Estrogen signaling pathway
mmu04921  Oxytocin signaling pathway
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    16524 (Kcnj9)
   04921 Oxytocin signaling pathway
    16524 (Kcnj9)
  Nervous system
   04728 Dopaminergic synapse
    16524 (Kcnj9)
   04726 Serotonergic synapse
    16524 (Kcnj9)
   04723 Retrograde endocannabinoid signaling
    16524 (Kcnj9)
  Environmental adaptation
   04713 Circadian entrainment
    16524 (Kcnj9)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    16524 (Kcnj9)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   16524 (Kcnj9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 16524
NCBI-ProteinID: NP_032455
MGI: 108007
Ensembl: ENSMUSG00000038026
Vega: OTTMUSG00000050096
UniProt: P48543 Q544N3
Position
1 H3; 1 79.66 cM
AA seq 393 aa AA seqDB search
MAQENAAFSPGSEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK
VEEEGAGEGAGAGDGADKEHNGCLPPPESESKV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggagaacgccgctttctctcccgggtcggaggagccgccacgccgccgcggt
cgccagcgctacgtggagaaggacggtcgctgtaacgtgcagcagggcaacgtccgcgag
acctaccgctacctgaccgacctgttcaccacgctggtggacctgcagtggcgcctcagc
ctgctcttcttcgtgctcgcctacgcgctcacttggctcttcttcggcgccatctggtgg
ctcatcgcctacggccgcggcgacctggaacacctggaggacaccgcgtggaccccgtgc
gtcaacaacctcaacggcttcgtggccgccttcctcttctccatcgagacggagaccacc
atcggctatgggcaccgggtcatcaccgaccagtgtcccgagggcatcgtgctgctgctg
ctgcaggctatcctgggctccatggtgaacgctttcatggtgggctgcatgttcgtcaag
atctcgcagcccaacaagcgcgccgccactctcgtcttctcctcgcacgccgtggtgtct
ctgcgcgacgggcgcctctgtctcatgtttcgcgtgggcgacctgcgatcctcgcacatc
gtcgaggcctccatccgcgccaagctcatccgctcccgtcagacgctcgagggcgagttc
atccctttgcaccagaccgacctcagcgtgggctttgacacgggggacgaccgcctcttt
ctcgtctcacctctcgtcatcagccacgaaatcgatgccgccagccccttctgggaggca
tcgcgccgcgccctcgagagggacgacttcgagatcgtagtcattctcgagggcatggtg
gaggccacgggaatgacgtgccaagctcgaagctcgtacctggtggatgaagtgttgtgg
ggccaccggttcacatcggtgctcaccctggaggatggtttctatgaggtggactacgcc
agcttccacgaaacctttgaggtgcccacaccctcgtgcagtgctcgggaactggcagaa
gccgcggcccgcctcgatgcccatctctactggtccatccccagcaggctggatgagaag
gtggaggaagaaggggctggggagggggcaggtgcgggagatggagctgacaaggagcac
aatggctgcctgccacccccagagagtgagtccaaggtgtga

DBGET integrated database retrieval system