KEGG   Mus musculus (mouse): 16528Help
Entry
16528             CDS       T01002                                 

Gene name
Kcnk4, MLZ-622, TRAAK, TRAAKt, Tex40
Definition
(RefSeq) potassium channel, subfamily K, member 4
  KO
K04915  
potassium channel subfamily K member 4
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCNK, K2px.x
   16528 (Kcnk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 A; 19 5.08 cM
AA seq 398 aa AA seqDB search
MRSTTLLALLALVLLYLVSGALVFQALEQPHEQQAQKKMDHGRDQFLRDHPCVSQKSLED
FIKLLVEALGGGANPETSWTNSSNHSSAWNLGSAFFFSGTIITTIGYGNIVLHTDAGRLF
CIFYALVGIPLFGMLLAGVGDRLGSSLRRGIGHIEAIFLKWHVPPGLVRSLSAVLFLLIG
CLLFVLTPTFVFSYMESWSKLEAIYFVIVTLTTVGFGDYVPGDGTGQNSPAYQPLVWFWI
LFGLAYFASVLTTIGNWLRAVSRRTRAEMGGLTAQAASWTGTVTARVTQRTGPSAPPPEK
EQPLLPSSLPAPPAVVEPAGRPGSPAPAEKVETPSPPTASALDYPSENLAFIDESSDTQS
ERGCALPRAPRGRRRPNPSKKPSRPRGPGRLRDKAVPV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcaccacactcctggctctgctggcactggtgctgctttacttggtatctggg
gctctagtgttccaggctctggagcagcctcacgagcagcaggctcagaagaaaatggat
catggccgagaccagtttctgagggaccatccctgtgtgagccagaagagcctggaggat
ttcatcaagctcctggttgaagccctgggagggggcgcaaacccagaaaccagctggacc
aatagcagcaaccactcatcagcttggaacctgggcagcgccttctttttctcggggacc
atcatcactaccatcggctatggcaatatagtcttacacacagatgccgggcgtctcttt
tgtatcttctatgcactggtggggatcccactgttcgggatgctgctggcgggagtcggg
gaccggctgggctcctctctgcgccggggcatcggccacatcgaagcaatcttcttgaag
tggcatgtgccaccggggctggtgagaagtctgtccgcagtgctcttcctgctgatcggc
tgcctgctctttgtcctcactcctaccttcgtgttctcctacatggagagctggagcaag
ttagaagccatctactttgttatagtgactctcaccactgtaggctttggcgattatgta
cccggcgatggcaccgggcagaactctccagcctaccagccgctggtgtggttctggatc
ttgtttggcctagcctacttcgcctcagtgctcaccaccatcggcaactggttgcgagca
gtgtcccgccgaactcgggcagagatgggtggcctaacggcacaggctgctagctggacc
ggcacagtgacagcgcgagtgacccagcgaactgggcccagcgccccgccgccagagaag
gagcaaccactcctgccctcctctttgccggcaccgcctgctgttgttgagccagccggc
aggcccggctcccctgcacccgcagagaaggttgagactccgtccccgcccacggcctca
gctctggattaccccagtgagaatctggccttcatcgacgagtcctcagacacgcagagt
gagcgtggctgtgccctgcctcgggctcctcggggtcgccgccgacccaacccatccaaa
aagccttccagaccccggggtcctgggcgactccgagacaaggccgtgccggtgtag

DBGET integrated database retrieval system