KEGG   Mus musculus (mouse): 16531Help
Entry
16531             CDS       T01002                                 

Gene name
Kcnma1, 5730414M22Rik, BKCa, MaxiK, Slo, Slo1, mSlo, mSlo1
Definition
(RefSeq) potassium large conductance calcium-activated channel, subfamily M, alpha member 1
  KO
K04936  
potassium large conductance calcium-activated channel subfamily M alpha member 1
Organism
mmu  Mus musculus (mouse)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Renin secretion
Salivary secretion
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    16531 (Kcnma1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    16531 (Kcnma1)
   04924 Renin secretion
    16531 (Kcnma1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    16531 (Kcnma1)
  Digestive system
   04970 Salivary secretion
    16531 (Kcnma1)
   04972 Pancreatic secretion
    16531 (Kcnma1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   16531 (Kcnma1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
14; 14 A3
AA seq 1209 aa AA seqDB search
MANGGGGGGGSSGGGGGGGGGSGLRMSSNIHANHLSLDASSSSSSSSSSSSSSSSSSSSS
VHEPKMDALIIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCH
CGGKTKEAQKINNGSSQADGTLKPVDEKEEVVAAEVGWMTSVKDWAGVMISAQTLTGRVL
VVLVFALSIGALVIYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKL
WFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKL
VNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYA
KTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLES
VSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVK
IESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSW
NWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNE
MYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRSRKRILINPGNHLKIQE
GTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLEDEQPPTLSPKKKQRNGG
MRNSPNTSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAA
MTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLH
NFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQ
FDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELAKPGKLPLV
SVNQEKNSGTHILMITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLM
SATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLD
GPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELV
PTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSSKKSSSVHSIPSTANRPNRPKSRESRDK
QNRKEMVYR
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacggtggcggcggcggcggcggcagcagcggcggcggcggcggcggcggcgga
ggcagcggtcttagaatgagcagcaatatccacgcgaaccatctcagcctagacgcgtcc
tcctcctcctcttcctcctcctcttcttcttcttcctcctcctcttcctcctcgtcctcg
gtccacgagcccaagatggatgcgctcatcataccggtgaccatggaggtgccgtgcgac
agccggggccaacgcatgtggtgggctttcttggcctcctccatggtgactttcttcggg
ggcctcttcatcatcttgctctggcggacgctcaagtacctgtggaccgtttgctgccac
tgcgggggcaagacgaaggaggcccagaagataaacaatggctccagccaggcagatggt
actctcaagccagtggacgaaaaagaggaggtggtggcagccgaggtcggctggatgaca
tctgtgaaggactgggcaggggtgatgatatccgcccagacactgactggcagagtcctg
gttgtgttagtctttgctctcagcattggtgccctcgtaatatacttcatagactcgtca
aacccaatagaatcctgccagaatttctacaaagatttcacattacagatcgacatggct
ttcaacgtgttcttcctcctctactttggcttgcggtttattgcagccaacgataagctg
tggttctggctggaagtgaattcagtagtagatttcttcacagtccctcctgtgtttgtg
tctgtgtacttaaacagaagttggcttggcttgagatttttaagagctctcagactgata
cagttttcagagattttgcagtttctgaatatccttaaaacaagtaactccatcaagctg
gtgaatctgctctccatatttatcagcacgtggctgactgcagctggattcatccacttg
gtggagaattcaggggacccatgggaaaatttccaaaacaaccaggcacttacgtactgg
gaatgtgtctacttactcatggtcacaatgtctacagtgggttatggggacgtttatgca
aaaaccacacttggacgcctcttcatggtcttcttcatcctcgggggactggccatgttt
gccagctacgtccctgaaatcatagagttaataggaaaccgcaagaaatacgggggctcc
tatagcgcggttagtggaagaaagcacattgtagtctgtggacacattactctggagagt
gtctctaacttcctgaaggactttctgcacaaggaccgggatgatgtcaacgtggagatt
gtctttcttcacaacatctcccctaaccttgagcttgaggctctgttcaaacggcatttc
actcaggtggagttttatcagggctctgtcctcaatccacatgatcttgccagagtcaag
atagagtcagcagatgcatgcctgatccttgccaataagtattgcgctgacccggatgca
gaagatgcctccaacatcatgagagtgatctccatcaaaaactaccacccaaagatcagg
atcatcactcagatgctgcagtatcacaacaaggcccatctgctcaacatccccagctgg
aactggaaagagggtgatgacgcaatatgccttgcagagctcaagttgggtttcatagcc
cagagctgtctggctcaaggcctctccacaatgcttgccaatctcttctctatgaggtca
ttcataaagattgaggaagacacatggcagaaatactacttggaaggagtctccaatgaa
atgtacacagaatatctctccagtgccttcgtgggtctgtccttccctactgtttgtgag
ctgtgttttgtgaagcttaagctcctgatgatagccattgagtacaagtctgccaacaga
gagagccgaagccgaaagcgaatattaattaaccctgggaaccaccttaagatccaagaa
ggtactttaggatttttcatcgcaagtgatgccaaagaagttaaaagggcatttttttac
tgcaaggcctgtcatgatgacgtcacagatcccaaaagaattaaaaaatgtggctgcagg
cggcttgaagatgagcagccgccaaccctgtcaccaaaaaaaaaacaacgtaatgggggc
atgaggaactcgcccaacacctccccgaagctgatgaggcatgaccccttgttaattcct
ggcaatgatcagattgacaacatggactccaatgtgaaaaagtacgactccactggaatg
tttcactggtgtgcacccaaggagattgagaaagtcatcttgactcgaagtgaagctgcc
atgactgtcctgagtggccatgtcgtagtctgcatctttggggatgtcagctcagccctg
attggcctccggaacctggtgatgccacttcgtgctagcaactttcactatcatgagctc
aaacacattgtgtttgtgggctccattgagtacctcaagagggagtgggaaacactgcac
aacttcccgaaagtgtccatattgcctggtacaccattaagtcgggctgatttaagggct
gtcaacatcaacctctgtgacatgtgcgttatcctgtcagccaatcagaataatattgat
gatacttcgcttcaggacaaggaatgcatcttggcgtcactcaacatcaaatctatgcag
tttgatgacagcatcggggtcttgcaggctaattcccaaggattcacacctcctggaatg
gacagatcatcacccgacaacagcccagtgcacgggatgttacgccagccgtccatcaca
actggggtcaacattcccatcatcacggaactcgctaagccgggcaagttgcctttggta
tcagtcaatcaggaaaaaaacagtgggacgcacattctaatgataacggagttggtgaat
gataccaatgttcagtttttggaccaagacgatgacgatgaccctgacacagagctgtac
ctcacacagccctttgcttgtgggacagcatttgccgtcagcgtcctggactcactcatg
agcgcgacatacttcaatgacaatatcctcaccctaatacggaccctggtgacaggagga
gccacaccagagctcgaggctctaatagctgaggagaatgcacttcgaggaggctacagc
actccgcagacattggccaacagggaccgttgccgagtggcccagttagccctgttagat
ggtccctttgcagacttaggggatggtggttgttatggtgatctgttctgcaaagctctg
aaaacatataatatgctttgttttggaatttaccggctgagagatgcccacctcagcacc
cccagccagtgtacaaaaaggtacgtcatcaccaatcctccctacgagtttgagctcgta
ccaacagacctgatcttctgcctgatgcagtttgaccacaacgctggccaatcccgggcc
agtctgtctcattcctcccactcctcacagtcgtccagtaagaagagctcctccgtccac
tccatcccgtccacagcaaatcggccgaaccggcccaagtccagggagtcccgcgacaaa
cagaacagaaaagaaatggtttacagatga

DBGET integrated database retrieval system