KEGG   Mus musculus (mouse): 16535Help
Entry
16535             CDS       T01002                                 

Gene name
Kcnq1, AW559127, KVLQT1, Kcna9
Definition
(RefSeq) potassium voltage-gated channel, subfamily Q, member 1
  KO
K04926  
potassium voltage-gated channel KQT-like subfamily member 1
Organism
mmu  Mus musculus (mouse)
Pathway
Adrenergic signaling in cardiomyocytes
Cholinergic synapse
Gastric acid secretion
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    16535 (Kcnq1)
  Digestive system
   04971 Gastric acid secretion
    16535 (Kcnq1)
   04972 Pancreatic secretion
    16535 (Kcnq1)
   04974 Protein digestion and absorption
    16535 (Kcnq1)
  Nervous system
   04725 Cholinergic synapse
    16535 (Kcnq1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCNQ, Kv7.x (KQT-like)
   16535 (Kcnq1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 F5; 7 88.12 cM
AA seq 668 aa AA seqDB search
MDTASSPPSAERKRAGWSRLLGARRGSAVVKKCPFSLELAEGGPEGSTVYAPIAPTGAPG
LAPPMSTPVSPAPAPADLGPRPRVSLDPRVSIYSARRPLLARTHIQGRVYNFLERPTGWK
CFVYHFTVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCR
SKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHV
DRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRIEFGSYAD
ALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQ
KHFNRQIPAAASLIQTAWRCYAAENPDSATWKIYVRKPARSHTLLSPSPKPKKSVMVKKK
KFKLDKDNGMSPGEKMFNVPHITYDPPEDRRPDHFSIDGYDSSVRKSPTLLEVSTPHFLR
TNSFAEDLDLEGETLLTPITHVSQLRDHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDV
IEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFIPISEKSKDRGSNTIGARLNRVEDKVTQ
LDQRLVIITDMLHQLLSMQQGGPTCNSRSQVVASNEGGSINPELFLPSNSLPTYEQLTVP
QTGPDEGS
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggacacggcctcgtccccgcccagtgctgaaaggaagcgcgcgggttggagccgcctg
ctaggcgcccggcggggcagcgcggtggtcaagaagtgtcccttctcactggagctggcc
gaaggtggccctgagggcagcacggtctatgcgcccatcgcgccaaccggagcccccggg
ctcgcgccccccatgtcgaccccagtgtcgcccgccccggcccctgcagacctcggccca
cgtccgcgggtgagccttgacccgcgggtctccatctacagtgcgcgccgcccgctgctg
gcgcgcacccacatccagggccgagtctacaacttcctcgagcgccccacgggttggaag
tgtttcgtgtaccacttcaccgtcttcctcattgttctggtctgcctcatcttcagtgtc
ctgtccactattgagcagtatgccgctctggccaccgggaccctcttctggatggagatt
gtccttgtggtgttctttgggacagaatatgtggtccgcctctggtctgcaggctgccgc
agcaagtacgtgggcatctggggccggctacgttttgcccggaagcccatttccatcatt
gacctcatcgtggttgtagcctctatggttgtcctctgcgtgggttccaaaggacaagtg
ttcgccacatcagctatcaggggtatccgcttccttcagatcctgcggatgctgcatgtc
gatcgccaggggggtacctggaggctcctgggctctgtagtcttcattcaccgccaggag
ctgatcaccaccctgtacattggctttctgggccttatcttctcctcctactttgtctac
ttggctgagaaagatgcggtgaacgagtccggccgcatcgagtttggcagctacgcagat
gctctgtggtggggggtggtcacagtcactaccattggctacggggataaggtacctcag
acgtgggttgggaagaccatcgcctcctgtttctctgtcttcgccatatccttctttgca
ctcccagcggggatacttggctctgggttcgcgctgaaggtccagcagaagcagaggcag
aagcacttcaaccggcagatcccagctgcagcctcactcatccagactgcatggaggtgc
tatgccgctgagaaccctgactcagccacttggaagatctatgtccggaagcctgctcgg
agtcacacgcttctgtcccccagccccaaacctaaaaagtctgtcatggtaaagaagaag
aagttcaagctggataaggataatgggatgagtcctggagagaagatgttcaatgttcct
cacatcacttatgatcccccagaggataggaggccagaccatttctccattgatggctat
gacagctcagtaaggaagagccctacactgctggaagtaagcacaccccatttcttgaga
acaaacagctttgcagaggacctggacctggaaggggagacactgctgacccccatcacc
catgtgtcacagctgcgggatcaccatcgggccaccatcaaggtcatcaggcgcatgcag
tactttgtagccaagaagaaattccagcaagcacggaagccctacgacgtgcgagatgtc
atcgagcagtactcccagggccacctgaaccttatggtgcgcattaaagaactacagaga
aggctggatcagtccattgggaagccatctttgttcatccccatctcagaaaagagcaaa
gaccgtggcagtaacaccatcggtgcccgtctgaacagggtggaagacaaggtgacacaa
ctggaccagagactggtgatcatcacagacatgctccaccagctgctgtccatgcaacaa
ggtggtccaacctgcaacagcaggtcacaagttgtagccagcaatgaaggtggctccatc
aaccctgagctcttcctacccagcaacagcctgcccacctacgaacaactgactgtgccc
cagacaggccctgatgagggttcctga

DBGET integrated database retrieval system