KEGG   Mus musculus (mouse): 16536Help
Entry
16536             CDS       T01002                                 

Gene name
Kcnq2, HNSPC, KQT2, Nmf134
Definition
potassium voltage-gated channel, subfamily Q, member 2
Orthology
K04927  
potassium voltage-gated channel KQT-like subfamily member 2
Organism
mmu  Mus musculus (mouse)
Pathway
Cholinergic synapse
Class
Organismal Systems; Nervous system; Cholinergic synapse [PATH:mmu04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
2 H3-4; 2 103.57 cM
AA seq 759 aa AA seqDB search
MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSVLSKPRTG
GAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVFSCLVLSVFSTIKEYEK
SSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKFARKPFCVIDIMVLIASI
AVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYIGF
LCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLI
GVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLIQSAWRFYATNLSRTDLHSTW
QYYERTVTVPMYRLIPPLNQLELLRNLKSKSGLTFRKEPQPEPSPSQKVSLKDRVFSSPR
GMAAKGKGSPQAQTVRRSPSADQSLDDSPSKVPKSWSFGDRSRTRQAFRIKGAASRQNSE
EASLPGEDIVEDNKSCNCEFVTEDLTPGLKVSIRAVCVMRFLVSKRKFKESLRPYDVMDV
IEQYSAGHLDMLSRIKSLQSRIDMIVGPPPPSTPRHKKYPTKGPTAPSRESPQYSPRVDQ
IVGRGPTITDKDRTKGPAETELPEDPSMMGRLGKVEKQVLSMEKKLDFLVSIYTQRMGIP
PAETEAYFGAKEPEPAPPYHSPEDSRDHADKHGCIIKIVRSTSSTGQRNYAAPPAIPPAQ
CPPSTSWQQSHQRHGTSPVGDHGSLVLRLERSAGMMSCH
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaagtcgcgcaacggtggcgtgtaccccggcaccagcggggaaaagaagctc
aaggtgggcttcgtggggctggaccccggcgcgcccgactccacacgcgacggcgcgcta
ctcatcgcgggctccgaggcccccaagcgcggcagcgttttgagcaagccgcggacgggc
ggcgcgggagccgggaagcccccgaagcgcaacgccttctaccgcaagctgcagaatttc
ctctacaacgtgctagagcggccccgcggctgggcgttcatctaccacgcctacgtgttc
cttttagtcttctcctgccttgtgctttctgtgttttccaccatcaaggagtacgagaag
agctctgagggggccctctacatcttggaaatcgtgactatcgtggtattcggtgttgag
tactttgtgaggatctgggctgcaggctgctgttgccggtatcgaggctggaggggcagg
ctcaagtttgccaggaagccgttctgtgtgattgatatcatggtgctgattgcctccatt
gctgtgctggctgctggttcccagggcaatgtctttgccacatctgcgcttcggagcttg
cggttcttgcaaatcttgcggatgatccgtatggaccggaggggtggcacctggaagctc
ttgggatcggtagtctacgctcacagcaaggagctggtgactgcctggtacattggcttc
ctctgcctcatcctggcctcatttctggtgtacttggcagaaaagggtgagaatgaccac
tttgacacctacgcagatgcactctggtggggtctgatcaccctgacgaccattggctac
ggggacaagtaccctcagacctggaacgggaggctgctggcagcgacctttaccctcatt
ggtgtctcgttctttgctcttcctgctggcattttgggatccggctttgccctgaaagtc
caagagcagcatcggcaaaaacactttgagaaacggcggaaccctgcggcaggtctgatc
cagtctgcctggagattctatgctactaacctctcacgcaccgacctgcactccacgtgg
cagtactacgagcggacagtcactgtccccatgtacagactcatcccacctctgaaccag
ctggagctgctgaggaatctcaagagcaaatctggactcaccttcaggaaggagccacag
ccagagccatcaccaagtcagaaggtcagtttgaaagatcgtgtcttctccagcccccga
ggcatggctgccaagggaaaggggtctccccaggcccagacggtccggcggtcccccagt
gcggatcagagtcttgatgacagcccgagcaaggtgcccaagagctggagctttggtgac
cgcagccgcacacgccaggctttccgcatcaagggtgctgcatcccggcagaattcagaa
gaagcaagcctccctggggaggacatcgtagaggacaacaagagctgtaactgcgagttt
gtgactgaagatcttacccctggcctcaaagttagcatcagagctgtgtgtgttatgcgg
ttcttggtatctaagcgaaagttcaaagagagtctgcgcccatatgatgtgatggacgtc
atcgaacagtactcggctggacacttggatatgttgtcccgcatcaagagcctgcagtcc
aggatagatatgattgtgggccccccacccccttcaactccccggcacaagaagtaccct
accaaaggacccacggccccttcgagagagtcaccccagtactcacctagagtggaccag
attgtggggcggggcccaacaataacggataaggaccgcaccaaaggcccagcggaaacg
gagctgcccgaagaccccagcatgatgggacggcttgggaaggtggagaaacaggtcttg
tccatggaaaagaagctcgacttcttggtgagcatctatacacagagaatgggcatccca
ccagcagagacagaggcctattttggggccaaggagcctgagccggcaccaccctaccac
agcccagaggacagccgtgaccatgcagacaagcatggctgtatcattaagatcgtccgc
tccaccagctctacgggccagaggaactacgcagcacccccagccatcccccctgcccag
tgtcctccctccacctcgtggcagcagagccaccagcgccatggcacctcccctgtggga
gaccatggctcactggtcctgcgactggagaggagtgctggcatgatgagctgtcactag

DBGET integrated database retrieval system