KEGG   Mus musculus (mouse): 16536Help
Entry
16536             CDS       T01002                                 

Gene name
Kcnq2, HNSPC, KQT2, Nmf134
Definition
(RefSeq) potassium voltage-gated channel, subfamily Q, member 2
  KO
K04927  
potassium voltage-gated channel KQT-like subfamily member 2
Organism
mmu  Mus musculus (mouse)
Pathway
Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    16536 (Kcnq2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCNQ, Kv7.x (KQT-like)
   16536 (Kcnq2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 103.57 cM; 2 H3-4
AA seq 851 aa AA seqDB search
MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSVLSKPRTG
GAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVFSCLVLSVFSTIKEYEK
SSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKFARKPFCVIDIMVLIASI
AVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYIGF
LCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLI
GVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLIQSAWRFYATNLSRTDLHSTW
QYYERTVTVPMYSSQTQTYGASRLIPPLNQLELLRNLKSKSGLTFRKEPQPEPSPSQKVS
LKDRVFSSPRGMAAKGKGSPQAQTVRRSPSADQSLDDSPSKVPKSWSFGDRSRTRQAFRI
KGAASRQNSEASLPGEDIVEDNKSCNCEFVTEDLTPGLKVSIRAVCVMRFLVSKRKFKES
LRPYDVMDVIEQYSAGHLDMLSRIKSLQSRVDQIVGRGPTITDKDRTKGPAETELPEDPS
MMGRLGKVEKQVLSMEKKLDFLVSIYTQRMGIPPAETEAYFGAKEPEPAPPYHSPEDSRD
HADKHGCIIKIVRSTSSTGQRNYAAPPAIPPAQCPPSTSWQQSHQRHGTSPVGDHGSLVR
IPPPPAHERSLSAYGGGNRASTEFLRLEGTPACRPSEAALRDSDTSISIPSVDHEELERS
FSGFSISQSKENLDALGSCYAAVAPCAKVRPYIAEGESDTDSDLCTPCGPPPRSATGEGP
FGDVAWAGPRK
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaagtcgcgcaacggtggcgtgtaccccggcaccagcggggaaaagaagctc
aaggtgggcttcgtggggctggaccccggcgcgcccgactccacacgcgacggcgcgcta
ctcatcgcgggctccgaggcccccaagcgcggcagcgttttgagcaagccgcggacgggc
ggcgcgggagccgggaagcccccgaagcgcaacgccttctaccgcaagctgcagaatttc
ctctacaacgtgctagagcggccccgcggctgggcgttcatctaccacgcctacgtgttc
cttttagtcttctcctgccttgtgctttctgtgttttccaccatcaaggagtacgagaag
agctctgagggggccctctacatcttggaaatcgtgactatcgtggtattcggtgttgag
tactttgtgaggatctgggctgcaggctgctgttgccggtatcgaggctggaggggcagg
ctcaagtttgccaggaagccgttctgtgtgattgatatcatggtgctgattgcctccatt
gctgtgctggctgctggttcccagggcaatgtctttgccacatctgcgcttcggagcttg
cggttcttgcaaatcttgcggatgatccgtatggaccggaggggtggcacctggaagctc
ttgggatcggtagtctacgctcacagcaaggagctggtgactgcctggtacattggcttc
ctctgcctcatcctggcctcatttctggtgtacttggcagaaaagggtgagaatgaccac
tttgacacctacgcagatgcactctggtggggtctgatcaccctgacgaccattggctac
ggggacaagtaccctcagacctggaacgggaggctgctggcagcgacctttaccctcatt
ggtgtctcgttctttgctcttcctgctggcattttgggatccggctttgccctgaaagtc
caagagcagcatcggcaaaaacactttgagaaacggcggaaccctgcggcaggtctgatc
cagtctgcctggagattctatgctactaacctctcacgcaccgacctgcactccacgtgg
cagtactacgagcggacagtcactgtccccatgtacagctcacaaactcaaacctatggg
gcctccagactcatcccacctctgaaccagctggagctgctgaggaatctcaagagcaaa
tctggactcaccttcaggaaggagccacagccagagccatcaccaagtcagaaggtcagt
ttgaaagatcgtgtcttctccagcccccgaggcatggctgccaagggaaaggggtctccc
caggcccagacggtccggcggtcccccagtgcggatcagagtcttgatgacagcccgagc
aaggtgcccaagagctggagctttggtgaccgcagccgcacacgccaggctttccgcatc
aagggtgctgcatcccggcagaattcagaagcaagcctccctggggaggacatcgtagag
gacaacaagagctgtaactgcgagtttgtgactgaagatcttacccctggcctcaaagtt
agcatcagagctgtgtgtgttatgcggttcttggtatctaagcgaaagttcaaagagagt
ctgcgcccatatgatgtgatggacgtcatcgaacagtactcggctggacacttggatatg
ttgtcccgcatcaagagcctgcagtccagagtggaccagattgtggggcggggcccaaca
ataacggataaggaccgcaccaaaggcccagcggaaacggagctgcccgaagaccccagc
atgatgggacggcttgggaaggtggagaaacaggtcttgtccatggaaaagaagctcgac
ttcttggtgagcatctatacacagagaatgggcatcccaccagcagagacagaggcctat
tttggggccaaggagcctgagccggcaccaccctaccacagcccagaggacagccgtgac
catgcagacaagcatggctgtatcattaagatcgtccgctccaccagctctacgggccag
aggaactacgcagcacccccagccatcccccctgcccagtgtcctccctccacctcgtgg
cagcagagccaccagcgccatggcacctcccctgtgggagaccatggctcactggtacgc
atcccaccaccccctgcacacgagcggtcgctgtctgcctacggtgggggcaacagagcc
agtaccgagttcttgaggctggagggcaccccagcctgcaggccctctgaggctgccctg
cgggatagcgacacgtccatctccatcccttcggtggaccatgaggagctggagcgctcc
ttcagcggcttcagtatctcccagtccaaggagaacctggatgccctgggcagctgttat
gcagctgtggcaccatgcgccaaggtcaggccctacattgcagagggagagtctgacaca
gactcagacctctgcacaccatgtgggcctcccccacgctctgccactggtgagggcccc
tttggagatgtggcttgggcagggcccaggaaatga

DBGET integrated database retrieval system