KEGG   Mus musculus (mouse): 16563Help
Entry
16563             CDS       T01002                                 

Gene name
Kif2a, C530030B14Rik, Kif2, Kns2, M-kinesin
Definition
(RefSeq) kinesin family member 2A
  KO
K10393  
kinesin family member 2/24
Organism
mmu  Mus musculus (mouse)
Brite
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     16563 (Kif2a)
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    16563 (Kif2a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16563 (Kif2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13; 13 F
AA seq 705 aa AA seqDB search
MATANFGKIQIGIYVEIKRSDGRIHQAMVTSLNEDNESVTVEWIENGDTKGKEIDLESIF
SLNPDLVPDEDIEPSPELPPPSSSSKVNKIVKNRRTVAAVKNDPPPRDNRVVGSARARPS
QLPEQSSSAQQNGSVSDISPVQAAKKEFGPPSRRKSNCVKEVEKLQEKREKRRLQQQELR
EKRAQDVDATNPNYEIMCMIRDFRGSLDYRPLTTADPIDEHRICVCVRKRPLNKKETQMK
DLDVITIPSKDVVMVHEPKQKVDLTRYLENQTFRFDYAFDDSAPNEMVYRFTARPLVETI
FERGMATCFAYGQTGSGKTHTMGGDFSGKNQDCSKGIYALAARDVFLMLKKPNYKKLELQ
VYATFFEIYSGKVFDLLNRKTKLRVLEDGKQQVQVVGLQEREVKCVEDVLKLIDIGNSCR
TSGQTSANAHSSRSHAVFQIILRRKGKLHGKFSLIDLAGNERGADTSSADRQTRLEGAEI
NKSLLALKECIRALGRNKPHTPFRASKLTQVLRDSFIGENSRTCMIATISPGMASCENTL
NTLRYANRVKELTVNPAAAGDVHPIMHHPPSQIDDLETQWGVGSSPQRDDLKLLCEQNEE
EVSPQLFTFHEAVSQMVEMEEQVVEDHRAVFQESIRWIEDEKALLEMTEEVDYDVDSYAT
QLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggccaacttcggcaagatccagatcgggatttacgtggagatcaagcgcagc
gatggccgaatacaccaagcaatggtaacatctttaaatgaagataatgaaagtgtaact
gttgagtggatagaaaatggagatacgaaaggcaaagagattgacttggagagcatcttt
tcacttaaccctgaccttgtacctgatgaagatattgagcccagtccagaactacctcca
ccctcgtcatcctcaaaagttaacaaaattgtaaagaaccggcggactgtggcagctgtt
aagaatgaccctcccccgagagataatagagtggttggttcagcacgcgcacggcctagt
cagcttcctgagcaatcgtcttctgcacaacagaatggtagcgtttcagatatatctcca
gttcaagctgcaaaaaaggagtttggccctccttcacgtagaaaatccaattgtgtgaaa
gaagtagaaaaattgcaagaaaaacgagaaaaaaggagattgcaacagcaagaacttaga
gaaaaaagagcccaggatgttgatgctacaaatccaaattacgaaattatgtgtatgatc
agagacttcagagggagcttggattacagacccctaacaacagcagatcctattgatgaa
cataggatatgtgtttgtgtaagaaaacgaccactcaataaaaaagaaactcaaatgaaa
gatcttgatgtgatcacaatccctagtaaagatgttgtgatggtccacgaacccaaacag
aaagtagacttaacaaggtacttagaaaatcagacatttcggtttgattacgccttcgat
gactcagctcctaatgaaatggtttacaggtttactgctaggccactagtggaaacaata
tttgaaaggggcatggctacgtgctttgcttatgggcagactggaagtgggaaaactcat
actatgggtggtgacttttcaggaaagaaccaggattgttctaagggaatttatgcatta
gcagctcgcgatgtctttttaatgctgaagaagccaaactataagaaactagaacttcaa
gtatatgcaacattttttgaaatttatagtggaaaggtgtttgacttactaaataggaaa
acaaaattaagagtactagaagatgggaagcagcaggtccaagtggtggggctgcaggag
cgggaggtgaagtgtgtggaggacgtgctgaagctcatcgacataggcaacagctgcaga
acatctggccaaacatctgcaaatgcacattcatctcggagccatgcagtgttccagatc
attctaagaaggaaggggaaactacatggtaaattttctctcattgacctggctgggaac
gaaagaggagctgatacatccagtgcagacaggcaaaccaggcttgaaggtgctgaaatt
aataaaagccttttagcactcaaggagtgcatccgagccttaggtagaaacaaaccccat
acgcctttccgagcgagcaaactcactcaggtgctgagagattccttcataggtgaaaat
tctcgtacctgcatgattgccacaatctctccaggaatggcatcctgtgaaaatactctt
aatacgttaagatatgcaaatagggtgaaagaattgactgtaaatccagctgctgctggc
gatgtccatccaataatgcaccatccaccgagccagattgatgacttagagacacagtgg
ggtgtggggagttctcctcagagagatgatctaaaacttctctgtgaacaaaatgaagaa
gaagtttctccacagctgttcactttccatgaagctgtctcccagatggtagagatggaa
gagcaggttgtggaagatcatagggcagtgttccaggaatccattcgctggatagaagat
gaaaaggctctcctagagatgactgaagaagtagactatgatgtagactcatatgctaca
caacttgaagctattcttgagcaaaaaatagacattttaactgagttacgagataaagtg
aaatcttttcgcgcagcgctacaagaagaagagcaagcaagcaagcaaattaaccccaag
aggccccgagccctctaa

DBGET integrated database retrieval system