KEGG   Mus musculus (mouse): 16572Help
Entry
16572             CDS       T01002                                 

Gene name
Kif5a, D10Bwg0738e, Khc, Kif5, Kns, mKIAA4086
Definition
(RefSeq) kinesin family member 5A
  KO
K10396  
kinesin family member 5
Organism
mmu  Mus musculus (mouse)
Pathway
Endocytosis
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    16572 (Kif5a)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    16572 (Kif5a)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Others
    16572 (Kif5a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16572 (Kif5a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16572 (Kif5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10 D3; 10 74.5 cM
AA seq 1027 aa AA seqDB search
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVIIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENVETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEDSALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMRDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQTVELKKRHLEES
YDSLSDELARLQAHETVHEVALKDKEPDTQDAEEVKKALELQMENHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYERLKNEENEKSAKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNNLFQNYQNLHLQ
AAPSSTSDMYFASSGATSVAPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPL
HQETAAS
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atggcggagactaacaacgaatgcagcatcaaggtgctttgccgatttcggcccctgaac
caggccgagattctgcggggggacaagttcatccccattttccaaggggacgacagcgtc
attattgggggaaagccatatgtctttgaccgcgtcttccccccaaacaccactcaggag
caggtttaccacgcctgtgccatgcagatcgtcaaagacgtccttgctggttacaatggc
acaatcttcgcttatggacagacatcctcagggaaaacgcataccatggaggggaagctg
cacgaccctcagctgatgggcatcattccccggatcgctcgagacatcttcaaccacatc
tactccatggatgagaaccttgaattccacattaaggtatcttacttcgagatttacctg
gataagatccgtgaccttttggatgtgaccaagacgaacctgtccgtgcatgaggacaaa
aaccgggtgccgtttgtcaagggttgtaccgaacgctttgtgtccagcccagaggagatt
ctggatgtgatcgatgaggggaagtccaaccgtcacgtagctgtcaccaacatgaacgag
cacagttctcggagccacagcatcttcctcatcaacatcaagcaggagaacgtagagacc
gagcagaagctcagcgggaagctgtacctcgtggatctggccggaagcgagaaggtcagc
aagacaggggcagagggagccgttctggacgaggcaaagaatatcaacaagtcgctgtcg
gccctggggaacgtgatctctgcactggcagagggcaccaaaagctacgtgccgtaccgc
gacagcaaaatgacgaggattctccaggactctctgggagggaactgcaggactaccatg
ttcatctgctgctcgccgtccagctacaatgacgcagagaccaagtccacgctcatgttt
ggacagcgggcgaagaccatcaagaacactgcctcagtgaatctggagctgactgctgag
cagtggaagaagaagtatgagaaggagaaggagaagaccaaggcccagaaggagacaatt
gcgaagctagaggctgagcttagccggtggcgcaatggagagaatgtgcctgagactgag
cgcctggctggagaggactcagctctgggagctgagctctgcgaggagacccctgtgaat
gacaactcatccattgtggtacgcatcgcacctgaggaaaggcagaaatatgaggaagag
atccgccgtctctacaagcagcttgatgacaaggatgatgagatcaaccagcagagccag
ctcattgagaagctgaagcagcagatgctggaccaggaagagctgctcgtgtccactcgg
ggagacaacgagaaggtccagcgggagcttagccacctgcagtccgagaacgatgctgcg
aaggacgaggtgaaggaagtgctgcaggccctagaggagctggcggtcaactacgaccag
aagtcccaggaggtggaggagaagagccagcagaaccagctgctggtggacgagctgtcc
cagaaagtggccaccatgctgtccctggagtccgagctacagcggctccaggaggtcagt
ggacaccagcgaaagcggatcgctgaggtgctgaatgggctgatgagggacctgagtgag
ttcagtgtcatcgtgggcaacggcgagattaagctgcccgtggagatcagtggggccatc
gaggaggagttcacggtggcccggctctacatcagcaagatcaagtcggaggtgaagtcc
gtggttaagcgatgtcggcagctggagaacctccaggtggagtgtcatcgcaagatggag
gtgaccggtagggagctgtcatcttgccaactgctcatctcacagcatgaggccaagatc
cgttcactcacggagtacatgcagactgtggagttgaagaaacggcacctggaagagtcc
tacgactccctgagcgatgagcttgccaggctccaggcgcacgaaactgtacacgaggta
gctctgaaagacaaggagccagacacacaggacgcggaggaggtgaagaaggccctggaa
ctacagatggagaatcaccgtgaggcccatcaccggcagctggcccgcctccgggatgag
attaatgagaaacagaaaaccattgatgagctgaaagacctgaaccagaagctccagtta
gagctggagaagcttcaggccgactatgagaggctgaagaatgaagagaacgagaagagc
gccaagctccaggagctgacatttctgtatgagcgacatgagcagtccaagcaggacctc
aaggggctggaggagacagttgcccgtgaactccagaccctccacaaccttcgcaagctg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggagcccgaggacagt
ggggggattcattcccaaaagcagaagatctcctttcttgagaacaacctggaacagctt
acaaaggttcacaaacagctggtacgtgacaatgcagatctgcgttgtgagcttcctaaa
ttggaaaaacgacttcgggctacggctgagagagttaaggccctggagggtgcactgaag
gaggccaaggagggcgctatgaaggacaagcgtagataccagcaggaggtggaccgcatc
aaagaagccgtgcggtacaagagctccggcaagcggggccattctgcccagatcgctaag
cctgtgaggcctggccactatcctgcctcctcacccaccaacccctacggcacccggagc
cccgagtgtatcagctacaccaacaacctcttccagaactaccagaacctgcacctgcag
gctgcgcctagctccacttcagatatgtactttgccagcagcggagccacatctgttgcc
cccttggcttcctaccagaaggccaacatggacaatggaaatgccacagatatcaacgac
aacaggagtgacctgccgtgtggctatgaggctgaggaccaggccaagcttttccctctc
caccaagagacagcagccagctaa

DBGET integrated database retrieval system