KEGG   Mus musculus (mouse): 16612Help
Entry
16612             CDS       T01002                                 

Gene name
Klk1, 0610007D04Rik, KAL-B, Kal, Klk1b6, Klk6, mGk-6
Definition
(RefSeq) kallikrein 1 (EC:3.4.21.35)
  KO
K01325  
tissue kallikrein [EC:3.4.21.35]
Organism
mmu  Mus musculus (mouse)
Pathway
Renin-angiotensin system
Endocrine and other factor-regulated calcium reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    16612 (Klk1)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    16612 (Klk1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.35  tissue kallikrein
     16612 (Klk1)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   16612 (Klk1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   16612 (Klk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 B4; 7 28.74 cM
AA seq 261 aa AA seqDB search
MRFLILFLALSLGGIDAAPPVQSRIVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWV
LTAAHCHNDKYQVWLGKNNFLEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSND
LMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVKYEYPDELQCVNLKLLP
NEDCAKAHIEKVTDDMLCAGDMDGGKDTCAGDSGGPLICDGVLQGITSWGPSPCGKPNVP
GIYTRVLNFNTWIRETMAEND
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcctgatcctgttcctagccctgtccctaggagggattgatgctgcacctcct
gtccagtctcgaattgttggaggatttaactgtgagaagaattcccagccctggcaagtg
gctgtgtaccgcttcaccaaatatcaatgtgggggtatcctgctgaacgccaactgggtt
ctcacagctgcccactgccataatgacaagtaccaggtgtggctgggcaaaaacaacttt
ttggaggatgaaccctctgcccaacaccggcttgtcagcaaagccatccctcaccctgac
ttcaacatgagcctcctgaatgagcacaccccacaacctgaggatgactacagcaatgac
ctgatgctgctccgcctcaaaaagcctgctgacatcacagatgttgtgaagcccatcgac
ctgcccactgaggagcccaagctggggagcacatgcctagcctcaggctggggcagcatt
acacccgtcaaatatgaatacccagatgagctccagtgtgtgaacctcaagctcctgcct
aatgaggactgtgccaaagcccacatagagaaggtgacagatgacatgttgtgtgcagga
gatatggatggaggcaaagacacttgtgcgggtgactcaggaggcccactgatctgtgat
ggtgttctccaaggtatcacatcatggggccctagcccttgcggtaaacccaatgtgccg
ggtatctacaccagagttttaaatttcaacacctggataagagaaactatggctgaaaat
gactga

DBGET integrated database retrieval system