KEGG   Mus musculus (mouse): 16649Help
Entry
16649             CDS       T01002                                 

Gene name
Kpna4, 1110058D08Rik, IPOA3
Definition
(RefSeq) karyopherin (importin) alpha 4
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
3; 3 E2
AA seq 521 aa AA seqDB search
MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPQEDICEDS
DIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILV
HCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWA
LGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETI
QEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKV
QTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQ
VQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLL
TVKDAQVVQVVLDGLSNILKMAEDQAETIANLIEECGGLEKIEQLQNHENEDIYKLAYEI
IDQFFSSDDIDEDPSLVPESVQGGTFGFNSSTNVPTEGFQF
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaacgagaaattggacaaccaacggctcaagaattttaagaacaaaggccgt
gacttggagactatgagaagacaacgaaatgaagttgtagttgaattaaggaagaataaa
agagatgaacatctcttaaagagaaggaatgtaccacaagaagatatctgtgaagactcc
gatatagatggtgattatagagtgcaaaatacctctctagaagctattgttcaaaatgct
tcaagtgataaccaaggaattcaattaagtgcagttcaagctgctaggaagcttttatcc
agtgatcgaaatccaccaattgatgacttaataaaatctggaatattgcctattttagtt
cattgtcttgaaagagatgacaatccttctttacagtttgaagctgcgtgggctttgaca
aacattgcatctggaacgtctgaacaaacgcaagcagtggttcagtccaatgctgtgcca
cttttcttgaggcttctgcattcaccccatcagaatgtctgtgaacaggcagtatgggcg
ttgggaaacatcataggtgatggacctcagtgtagagattatgtgataagtcttggagtt
gtaaaacctctgctttcattcataagtccatctattcctataacattcttaagaaatgtt
acctgggttatggtcaatttatgtcgccacaaagacccaccaccaccaatggagacaatt
caggagattcttccagctctttgtgtattaattcatcacacagatgtaaatatcctggta
gatactgtctgggccctgtcttaccttacggatgctggcaatgaacagatacagatggta
atagactctggcatagttcctcacttggttccgctactcagccaccaggaagttaaagtt
cagactgctgcactgcgagctgtgggcaacattgtcactggaactgatgagcaaacacaa
gtagttttaaactgtgatgctctctcacacttcccagcactcctcactcatcccaaagag
aaaattaataaagaagcagtgtggttcctctccaacatcactgcaggaaatcaacagcag
gttcaggcagtaattgatgccaatcttgtaccaatgataatacaccttttggataaggga
gattttggcactcagaaagaagctgcctgggccataagtaacttaacaatcagcggaagg
aaagaccaagtggcctatcttatccaacaaaatgttattccacctttttgcaatttgctg
actgtaaaagatgcacaagttgtgcaagtagtacttgatggactaagtaatatattaaaa
atggctgaagatcaagcagaaaccatagccaatctcatagaagaatgtggtggactggag
aaaattgaacaacttcagaatcatgaaaatgaggacatctacaaattggcctatgagatc
attgaccagttcttctcttcagatgatattgatgaagatcctagccttgttccagagtca
gttcaaggtggaacatttggtttcaattcatcgaccaatgtaccaacagaggggttccag
ttttag

DBGET integrated database retrieval system