KEGG   Mus musculus (mouse): 16691Help
Entry
16691             CDS       T01002                                 

Gene name
Krt8, AA960620, AL022697, AU019895, Card2, EndoA, K8, Krt-2.8, Krt2-8
Definition
(RefSeq) keratin 8
  KO
K07605  
type II keratin, basic
Organism
mmu  Mus musculus (mouse)
Brite
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16691 (Krt8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16691 (Krt8)
  Exosomal proteins of other body fluids (saliva and urine)
   16691 (Krt8)
  Exosomal proteins of colorectal cancer cells
   16691 (Krt8)
  Exosomal proteins of bladder cancer cells
   16691 (Krt8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 F3; 15 57.2 cM
AA seq 490 aa AA seqDB search
MSIRVTQKSYKMSTSGPRAFSSRSFTSGPGARISSSSFSRVGSSSSSFRGSMGTGVGLGG
FGGAGVGGITAVTVNQSLLSPLKLEVDPNIQAVRTQEKEQIKSLNNKFASFIDKVRFLEQ
QNKMLETKWSLLQQQKTSRSNMDNMFESYINNLRRQLEALGQEKLKLEAELGNMQGLVED
FKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQIHEEEIRE
LQSQISDTSVVLSMDNSRSLDMDGIIAEVRAQYEDIANRSRAEAETMYQIKYEELQTLAG
KHGDDLRRTKTEISEMNRNINRLQAEIEALKGQRASLEAAIADAEQRGEMAIKDAQTKLA
ELEAALQRAKQDMARQLREYQELMNVKLALDIEITTYRKLLEGEESRLESGMQNMSIHTK
TTSGYSGGLSSSYGGLTSPGFSYGMSSFQPGFGSAGGSNTFSRTTKAVVVKKIETRDGKL
VSESSDVVSK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcagggtgactcagaaatcctacaagatgtccacctccggtccccgggccttc
agcagccgctcgttcacgagtggacccggtgcccgcatcagctcttccagcttttcccgg
gtgggcagcagcagcagcagcttccggggaagcatgggcaccggcgtgggtctgggcggc
tttggcggggctggtgtcgggggcatcacagccgtcacggtgaaccagagcctgttgagc
cccttgaagctggaggtggaccccaacatccaggctgtgcgcactcaggagaaggagcag
attaaatccctgaacaacaagttcgcctccttcattgacaaggtgcgcttcctggagcag
cagaacaagatgctggagaccaagtggagcctgttgcagcagcagaagacgtcgaggagc
aacatggacaacatgtttgagagctacatcaacaacctccgccggcagctggaagccctg
ggccaggagaagctgaagctggaggctgagcttggcaacatgcagggcctggtggaggac
ttcaagaataagtatgaggatgagatcaacaagcgtacagagatggagaatgaatttgtc
ctcatcaagaaggatgtggacgaagcatacatgaacaaggtggaactagagtcccgcctg
gaaggactgaccgacgagatcaacttcctccggcagatccatgaagaggagatccgtgag
ttgcagtctcagatctcagacacgtctgtggtgctgtctatggacaacagccgctccctg
gacatggatggcatcatcgctgaagttcgtgcccagtacgaggacattgccaatcgcagc
cgagctgaggctgaaaccatgtaccagattaagtatgaggaattgcagaccctggctggg
aagcacggggatgatctgcgccgcacaaagacagagatctccgagatgaaccgcaacatc
aaccgcctgcaggcggagattgaagccctcaaaggccagagggcatcgttggaggcagcc
atcgctgatgctgagcagcgtggggagatggccattaaggatgcccagaccaagctggct
gagctggaggctgccctgcaacgggccaagcaggacatggccaggcagctgcgcgagtac
caggagcttatgaacgtcaagctggccctggacatcgagatcaccacctaccgcaagctg
ctggagggggaggagagcaggctggagtctgggatgcagaacatgagcattcatacgaag
accaccagcggctactcaggaggactgagttcatcctatgggggactcactagccctggc
ttcagctacggaatgagctccttccagcccggcttcggttctgccgggggatccaacact
ttcagccgcaccaccaaggctgtggttgtgaagaagattgaaacccgagatgggaagctg
gtgtccgagtcttctgatgtcgtgtccaagtga

DBGET integrated database retrieval system