KEGG   Mus musculus (mouse): 16706Help
Entry
16706             CDS       T01002                                 

Gene name
Ksr1, AW492498, B-KSR1, D11Bhm183e, D11Bhm184e, Ksr, RSU2, hb
Definition
(RefSeq) kinase suppressor of ras 1
  KO
K14958  
kinase suppressor of Ras 1
Organism
mmu  Mus musculus (mouse)
Pathway
Ras signaling pathway
Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    16706 (Ksr1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    16706 (Ksr1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: TKL group
  RAF family [OT]
   16706 (Ksr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11 B5; 11 46.74 cM
AA seq 873 aa AA seqDB search
MDRAALRAAAMGEKKEGGGGGAAADGGAGAAVSRALQQCGQLQKLIDISIGSLRGLRTKC
SVSNDLTQQEIRTLEAKLVKYICKQQQSKLSVTPSDRTAELNSYPRFSDWLYIFNVRPEV
VQEIPQELTLDALLEMDEAKAKEMLRRWGASTEECSRLQQALTCLRKVTGLGGEHKMDSG
WSSTDARDSSLGPPMDMLSSLGRAGASTQGPRSISVSALPASDSPVPGLSEGLSDSCIPL
HTSGRLTPRALHSFITPPTTPQLRRHAKLKPPRTPPPPSRKVFQLLPSFPTLTRSKSHES
QLGNRIDDVTPMKFELPHGSPQLVRRDIGLSVTHRFSTKSWLSQVCNVCQKSMIFGVKCK
HCRLKCHNKCTKEAPACRITFLPLARLRRTESVPSDINNPVDRAAEPHFGTLPKALTKKE
HPPAMNLDSSSNPSSTTSSTPSSPAPFLTSSNPSSATTPPNPSPGQRDSRFSFPDISACS
QAAPLSSTADSTRLDDQPKTDVLGVHEAEAEEPEAGKSEAEDDEEDEVDDLPSSRRPWRG
PISRKASQTSVYLQEWDIPFEQVELGEPIGQGRWGRVHRGRWHGEVAIRLLEMDGHNQDH
LKLFKKEVMNYRQTRHENVVLFMGACMNPPHLAIITSFCKGRTLHSFVRDPKTSLDINKT
RQIAQEIIKGMGYLHAKGIVHKDLKSKNVFYDNGKVVITDFGLFGISGVVREERRENQLK
LSHDWLCYLAPEIVREMIPGRDEDQLPFSKAADVYAFGTVWYELQARDWPFKHQPAEALI
WQIGSGEGVRRVLASVSLGKEVGEILSACWAFDLQERPSFSLLMDMLERLPKLNRRLSHP
GHFWKSADINSSKVMPRFERFGLGTLESGNPKM
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atggatagagcggcgttgcgcgcggcagcgatgggcgagaaaaaggagggcggcggcggg
ggcgccgcggcggacgggggcgcaggggccgccgtcagccgggcgctgcagcagtgcggc
cagctgcagaagctcatcgatatctccatcggcagtctgcgcgggctgcgcaccaagtgc
tcagtgtctaacgacctcacacagcaggagatccggaccctagaggcaaagctggtgaaa
tacatttgcaagcagcagcagagcaagcttagtgtgaccccaagcgacaggaccgccgag
ctcaacagctacccacgcttcagtgactggctgtacatcttcaacgtgaggcctgaggtg
gtgcaggagatcccccaagagctcacactggatgctctgctggagatggacgaggccaaa
gccaaggagatgctgcggcgctggggggccagcacggaggagtgcagccgcctacagcaa
gcccttacctgccttcggaaggtgactggcctgggaggggagcacaaaatggactcaggt
tggagttcaacagatgctcgagacagtagcttggggcctcccatggacatgctttcctcg
ctgggcagagcgggtgccagcactcagggaccccgttccatctccgtgtccgccctgcct
gcctcagactctccggtccccggcctcagtgagggcctctcggactcctgtatccccttg
cacaccagcggccggctgaccccccgggccctgcacagcttcatcacgccccctaccaca
ccccagctacgacggcacgccaagctgaagccaccaaggacacccccaccgccaagccgc
aaggtcttccagctgctccccagcttccccacactcacacggagcaagtcccacgagtcc
cagctgggaaaccgaatcgacgacgtcaccccgatgaagtttgaactccctcatggatcc
ccacagctggtacgaagggatatcgggctctcggtgacgcacaggttctccacaaagtca
tggttgtcacaggtgtgcaacgtgtgccagaagagcatgatttttggcgtgaagtgcaaa
cactgcaggttaaaatgccataacaagtgcacaaaggaagctcccgcctgcaggatcacc
ttcctcccactggccaggcttcggaggacagagtctgtcccgtcagatatcaacaaccca
gtggacagagcagcagagccccattttggaacccttcccaaggccctgacaaagaaggag
caccctccagccatgaacctggactccagcagcaacccatcctccaccacgtcctccaca
ccctcatcgccggcacctttcctgacctcatctaatccctccagtgccaccacgcctccc
aacccgtcacctggccagcgggacagcaggttcagcttcccagacatttcagcctgttct
caggcagccccgctgtccagcacagccgacagtacacggctcgacgaccagcccaaaaca
gatgtgctaggtgttcacgaagcagaggctgaggagcctgaggctggcaagtcagaggca
gaggatgacgaggaggatgaggtggacgacctccccagctcccgccggccctggaggggc
cccatctctcgaaaggccagccagaccagcgtttacctgcaagagtgggacatccccttt
gaacaggtggaactgggcgagcccattggacagggtcgctggggccgggtgcaccgaggc
cgttggcatggcgaggtggccattcggctgctggagatggacggccacaatcaggaccac
ctgaagctgttcaagaaagaggtgatgaactaccggcagacgcggcatgagaacgtggtg
ctcttcatgggggcctgcatgaacccacctcacctggccattatcaccagcttctgcaag
gggcggacattgcattcattcgtgagggaccccaagacgtctctggacatcaataagact
aggcagatcgcccaggagatcatcaagggcatgggttatcttcatgcaaaaggcatcgtg
cacaaggacctcaagtccaagaatgtcttctatgacaacggcaaagtggtcatcacagac
ttcgggctgtttgggatctcgggtgtggtccgagaggaacggcgcgagaaccaactgaaa
ctgtcacatgactggctgtgctacctggcccccgagatcgtacgagaaatgatcccgggg
cgggacgaggaccagctgcccttctccaaagcagccgatgtctatgcattcgggactgtg
tggtatgaactacaggcaagagactggccctttaagcaccagcctgctgaggccttgatc
tggcagattggaagtggggaaggagtacggcgcgtcctggcatccgtcagcctggggaag
gaagtcggcgagatcctgtctgcctgctgggctttcgatctgcaggagagacccagcttc
agcctgctgatggacatgctggagaggctgcccaagctgaaccggcggctctcccaccct
gggcacttttggaagtcggctgacattaacagcagcaaagtcatgccccgctttgaaagg
tttggcctggggaccctggagtccggtaatccaaagatgtag

DBGET integrated database retrieval system