KEGG   Mus musculus (mouse): 16765Help
Entry
16765             CDS       T01002                                 

Gene name
Stmn1, 19k, Lag, Lap18, Op18, P18, P19, Pig, Pp17, Pp18, Pp19, Pr22, Smn
Definition
(RefSeq) stathmin 1
  KO
K04381  stathmin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    16765 (Stmn1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    16765 (Stmn1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Stathmin
     16765 (Stmn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Stathmin Ribonuc_2-5A Exonuc_VII_L WTX
Motif
Other DBs
NCBI-GeneID: 16765
NCBI-ProteinID: NP_062615
MGI: 96739
Ensembl: ENSMUSG00000028832
Vega: OTTMUSG00000010830
UniProt: P54227 Q545B6
Position
4 D3; 4 66.76 cM
AA seq 149 aa AA seqDB search
MASSDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSLEEIQKKLEAAEER
RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL
ERLREKDKHVEEVRKNKESKDPADETEAD
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttctgatattcaggtgaaagagctggagaagcgcgcttcaggccaggctttt
gagctgattctcagccctcggtcaaaagaatctgtccccgatttccccctttccccccca
aagaagaaggacctttccctggaggaaatccagaagaaattagaagctgcagaagaaaga
cgcaagtctcatgaggcggaagtcttgaagcagctcgcggagaagcgggagcatgagaag
gaggtgctccagaaagccatcgaggagaacaacaacttcagcaagatggcggaggagaag
ctgacccacaaaatggaggctaacaaagagaaccgggaggcgcagatggcggccaagctg
gagcgcttgcgagagaaggacaagcacgtggaagaggtgcggaagaacaaagaatccaaa
gaccccgcggatgagactgaggctgactaa

DBGET integrated database retrieval system