KEGG   Mus musculus (mouse): 16779Help
Entry
16779             CDS       T01002                                 

Gene name
Lamb2, AW211941, Lamb-2, Lams
Definition
laminin, beta 2
Orthology
K06243  
laminin, beta 2
Organism
mmu  Mus musculus (mouse)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    16779 (Lamb2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    16779 (Lamb2)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    16779 (Lamb2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    16779 (Lamb2)
   05222 Small cell lung cancer
    16779 (Lamb2)
  Infectious diseases
   05146 Amoebiasis
    16779 (Lamb2)
   05145 Toxoplasmosis
    16779 (Lamb2)
Cell adhesion molecules and their ligands [BR:mmu04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      16779 (Lamb2)
   VLA-6
      16779 (Lamb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 F1; 9 59.4 cM
AA seq 1799 aa AA seqDB search
MEWASGEPGRGRQGQPLPWELRLGLLLSVLAATLAQAPSLDVPGCSRGSCYPATGDLLVG
RADRLTASSTCGLHSPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAP
QRRTAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRY
FSYDCGADFPGIPLAPPRRWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQ
NLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVIRGNCFCYGHASQCAPAPG
APAHAEGMVHGACICKHNTRGLNCEQCQDFYQDLPWHPAEDGHTHACRKCECNGHTHSCH
FDMAVYLASGNVSGGVCDGCQHNTAGRHCEFCRPFFYRDPTKDMRDPAVCRPCDCDPMGS
QDGGRCDSHDDPVLGLVSGQCRCKEHVVGTRCQQCRDGFFGLSASDPRGCQRCQCNSRGT
VPGSSPCDSSSGTCFCKRLVTGHGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEA
TGQCRCRQHMIGRRCEQVQPGYFRPFLDHLTWEAEAAQGQGLEVVERLVTNRETPSWTGP
GFVRLREGQEVEFLVTSLPRAMDYDLLLRWEPQVPEQWAELELMVQRPGPVSAHSPCGHV
LPKDDRIQGMLHPNTRFLVFPRPVCLEPGISYKLKLKLIGTGGRAQPETSYSGLLIDSLV
LQPHVLVLEMFSGGDAAALERRTTFERYRCHEEGLMPSKAPLSETCAPLLISVSALIYNG
ALPCQCDPQGSLSSECSPHGGQCRCKPGVVGRRCDVCATGYYGFGPAGCQACQCSPDGAL
SALCEGTSGQCPCRPGAFGLRCDHCQRGQWGFPNCRPCVCNGRADECDTHTGACLGCRDY
TGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDGYSQQIVCQCREG
YTGLRCEACAPGHFGDPSKPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHNTEGPHC
GYCKPGFHGQAARQSCHRCTCNLLGTDPRRCPSTDLCHCDPSTGQCPCLPHVQGLNCDHC
APNFWNFTSGRGCQPCACHPSRARGPTCNEFTGQCHCHAGFGGRTCSECQELYWGDPGLQ
CRACDCDPRGIDKPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHACFGDWDR
VVQDLAARTRRLEQWAQELQQTGVLGAFESSFLNMQGKLGMVQAIMSARNASAASTAKLV
EATEGLRHEIGKTTERLTQLEAELTAVQDENFNANHALSGLERDGLALNLTLRQLDQHLE
ILKHSNFLGAYDSIRHAHSQSTEAERRANASTFAVPSPVSNSADTRRRTEVLMGAQKENF
NRQHLANQQALGRLSAHAHTLSLTGINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGG
LGCSGAAATADLALGRARHTQAELQRALVEGGGILSRVSETRRQAEEAQQRAQAALDKAN
ASRGQVEQANQELRELIQNVKDFLSQEGADPDSIEMVATRVLDISIPASPEQIQRLASEI
AERVRSLADVDTILAHTMGDVRRAEQLLQDAHRARSRAEGERQKAETVQAALEEAQRAQG
AAQGAIWGAVVDTQNTEQTLQRVQERMAGAEKSLNSAGERARQLDALLEALKLKRAGNSL
AASTAEETAGSAQSRAREAEKQLREQVGDQYQTVRALAERKAEGVLAAQARAEQLRDEAR
DLLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5400 nt NT seq  +upstreamnt  +downstreamnt
atggagtgggcctcaggagaaccagggaggggcaggcagggacagcctttgccatgggaa
cttcgcttgggcctacttctaagtgtgctggctgccacattggcccaggccccgtccttg
gatgtacctggctgttctcgaggaagctgctatccagccaccggtgacctgttggtgggc
cgtgcggacagactgacggcctcatccacgtgtggcttgcatagccctcaaccctactgt
attgtcagtcacctgcaggacgaaaagaagtgtttcctgtgtgactcccgacgtcccttc
tctgctcgagacaacccaaatagtcatcggatccagaatgtagtcaccagctttgcgcca
caacgccggacagcctggtggcaatcggagaacggggttccaatggtcaccatccaactg
gacctggaagctgagtttcatttcacccacctcattatgacgttcaagacgttccggcct
gctgctatgctggtggagcgttctgcagactttggccgcacctggcacgtgtaccgatat
ttttcctatgactgcggggctgacttcccgggaatcccactggccccgccacgtcgctgg
gatgatgtagtgtgtgagtcccgctactcagaaatcgagccgtctacggaaggcgaggtc
atctatcgtgtgctggaccctgctattcctatcccagacccctacagctcacggattcag
aacctgttgaagatcaccaacctacgagtgaacttaacccggcttcacacactgggagac
aacttgcttgacccacggagggagatccgggaaaaatactattatgctctctatgaactt
gtcatccgtggcaactgcttctgctatggccacgcctcacagtgtgcgcctgcaccaggg
gcgccggcccatgctgagggcatggtacacggagcctgtatctgcaagcacaatactcgt
ggactcaactgtgagcagtgtcaggatttctatcaggaccttccctggcaccctgcagag
gacggccatactcacgcctgtcggaagtgtgagtgcaacgggcatactcatagctgccac
tttgacatggctgtctacctggcatctggaaatgtaagtggaggcgtatgcgatgggtgt
cagcacaacacagctgggcgccattgtgagttctgccggcccttcttctaccgtgacccc
accaaggacatgcgggacccagctgtgtgccgtccttgtgactgtgaccctatgggttct
caagatggtggtcgctgtgattctcatgatgaccctgtgctaggactggtctcaggccag
tgtcgctgcaaagaacacgtggttggcactcgctgccagcaatgccgtgatggcttcttt
ggacttagtgccagtgaccctcgagggtgccagcgttgccagtgtaattcacggggcaca
gtgcctgggagctccccttgtgactccagtagtggaacctgtttctgcaagcgtctggtg
accggacatggctgtgaccgctgtctgcctggccactggggcctgagccatgacctgctg
ggctgccgtccctgtgactgtgatgtgggcggtgccttggatcctcagtgtgatgaggcc
accggtcagtgccgctgccgccaacacatgattgggcggcgctgcgaacaagtgcagcct
ggctacttccggccttttctggaccatttaacctgggaggctgaggctgcccaagggcag
gggcttgaggtggtagagcggctggtgaccaaccgagagactccgtcctggactggccca
ggctttgtgcggctgcgagaaggtcaggaagtggagttcctggtgacctctttgcctagg
gccatggactatgacctgctactgcgctgggagccccaggtccctgagcaatgggcagag
ctggaactgatggtgcagcgtccggggcctgtgtctgctcacagtccgtgcgggcatgtg
ctgcctaaggatgaccgcattcaggggatgcttcacccaaacaccaggtttttggtgttt
cccagacctgtctgccttgagcctggcatctcctacaagctgaagctgaaactgatcgga
acagggggacgagcccagcctgaaacctcctactctggattactcattgactcgctggtc
ctgcagccccacgtcttggtgctagagatgtttagtgggggcgatgctgctgctctggag
cgccgtaccacctttgaacgctaccgctgccatgaggaaggtctgatgcccagcaaggcc
cctctatctgagacctgtgcccccctcctcatcagcgtgtccgccttgatctacaatggc
gccttgccatgtcagtgtgaccctcaaggctcactgagttctgaatgcagtcctcacggt
ggccagtgccggtgcaaacctggagtggttggacgccgttgtgatgtctgtgctactggc
tactatggctttggccctgcaggctgtcaagcctgccagtgtagtcctgatggagcactc
agtgccctctgtgaagggactagtggacagtgcccctgccgacctggtgcctttggtctt
cgctgtgaccactgtcaacgtggccagtggggattccctaattgccggccgtgtgtctgc
aatgggcgtgcggatgagtgtgatacccacacaggcgcttgcctgggctgccgtgattac
acggggggcgagcactgtgaaaggtgcattgctggttttcatggggacccacggctgcca
tatgggggccagtgccggccttgtccctgccctgaaggccctgggagccagcgacacttt
gctacttcttgccaccgggatggatattcccagcaaattgtgtgccagtgtcgagaaggc
tacacagggcttcggtgtgaagcttgtgcccccgggcactttggggacccatcaaagcca
ggtggcaggtgccaactgtgtgagtgcagtggaaacattgatcccatggaccctgatgcc
tgtgatccccacacggggcaatgcttgcgttgtttacacaacacagaggggccccactgt
ggctattgcaagcctggcttccatgggcaagctgcccgacagagctgtcaccgctgtacc
tgcaaccttctgggcacagatcccaggcggtgcccatctaccgacctgtgccattgtgac
ccaagcactgggcagtgcccatgccttccccatgtccaaggcctcaactgtgaccattgt
gcccccaacttttggaacttcaccagtggccgtggctgccagccttgtgcttgtcaccca
agccgggccagaggccctacctgcaatgagttcacagggcagtgtcactgtcatgctggc
tttggtgggaggacttgttctgagtgccaagagctctactggggagaccctggtctgcag
tgccgtgcctgtgactgtgatcctagaggaatagacaaacctcagtgtcatcgttccaca
ggccactgtagctgccgcccaggcgtgtctggtgtgcgctgtgaccagtgtgctcgtggc
ttctcaggggtttttcctgcttgtcacccctgccacgcttgctttggagactgggatcgt
gtggtacaggacctggctgctcggacgcggcgcctggagcagtgggctcaggagttgcag
caaacaggagtgctgggtgcctttgagagcagctttttgaacatgcaggggaagctaggc
atggtgcaggccattatgagtgcccgcaatgcctcagccgcctctacggcgaagcttgta
gaggccacagagggactacgtcatgaaatcgggaagaccaccgagcgcctgactcagtta
gaagcagagctaacagctgtgcaggatgagaacttcaatgccaaccatgcactcagtggt
ctggagagagacgggcttgcgcttaatctcaccctgaggcagctggatcagcatctggag
atcctcaaacattcaaatttcttaggtgcctatgacagcatccgacatgcccacagccag
tccacagaggcagagcgccgtgccaacgcctccacctttgcagtacccagccctgtgagc
aactcagcagatacccggcgtcggacggaagtgctaatgggtgcccaaaaagaaaacttc
aaccgccaacatttggccaaccagcaggcactgggacggctctctgcacatgcccacacc
ctgagcctgacgggcataaatgagttggtgtgtggggcaccaggggacgcaccctgtgcc
accagcccttgtgggggtgccggatgtcgggatgaagatgggcagccccgttgtggtggc
ctcggttgcagtggggcagcagccacggcagatctagcgctgggccgggctcggcacacg
caggcagagctgcagcgggcactggtagaaggtggcggcatcctcagccgggtgtctgag
actcgtcggcaggcagaagaggcacagcagcgagcacaggcagccctggacaaggctaat
gcttccaggggccaggtggaacaggccaatcaggagcttcgagaacttatccagaatgtg
aaagacttcctcagccaggagggagccgatcctgacagtattgaaatggtagcgactcgg
gtgctagacatctccatcccggcctcacccgagcagatccagcgcctagccagtgagatt
gcagaacgcgtccgaagcctggccgacgtggacacaatcctggcccataccatgggcgac
gtgcgtcgggctgaacagctactgcaagatgcgcaccgggcacggagccgggccgagggt
gagagacagaaggcagagacagtccaagcggcactggaggaggctcagagggcacaagga
gctgctcagggtgccatctggggagcagtggttgacacacaaaacacagagcagaccctg
cagcgggtccaggagaggatggcaggtgcagagaagtctctgaactctgccggtgagcgg
gctcggcaattagacgccctcctggaggccctgaaactgaaacgggcaggaaatagcctg
gcagcatctacagcggaagaaacagcaggcagtgcccagagccgtgccagggaggctgag
aaacaactacgggaacaagtaggtgaccaataccaaacagtgagggcgttggcagagcgg
aaggctgaaggtgttctggctgcacaagccagggcagaacaactgcgggatgaggctcgg
gacctgttgcaggccgctcaggataagctgcagcggctacaggagctggagggcacatat
gaggagaacgagcgtgcactggagggcaaagcggcccagctggatgggctggaagccagg
atgcgcagtgtgctccaggccatcaacttgcaggtccagatctacaacacctgccagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system