KEGG   Mus musculus (mouse): 16792Help
Entry
16792             CDS       T01002                                 

Gene name
Laptm5, E3
Definition
(RefSeq) lysosomal-associated protein transmembrane 5
  KO
K12387  
lysosomal-associated transmembrane protein
Organism
mmu  Mus musculus (mouse)
Pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    16792 (Laptm5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 D2.3
AA seq 261 aa AA seqDB search
MASRAAPVRQTCCCFNIRVATIALAIYHIVMSVLLFIEHVVEVARGKVSCRFFKMPYLRM
ADLLSSFLLIGVLFIISISLLFGVVKNREKYLIPFLSLQIMDFLLCLLTLLGSYIELPAY
LKLARPRPGPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEGVPH
SQFINMMLIFSVAFITVLILKVYMFKCVYTCYKFLKHMNSAMEDSSSKMFLKVALPSYEE
ALSLPPKTPEGDPAPPPYSEV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccgtgcagcgccggtcagacagacatgctgttgtttcaacatccgagtcgcc
accatagccctggccatttaccacatagtcatgagtgtcctgctgttcattgagcatgtg
gtggaggtggcccgcggtaaagtgtcctgtaggttcttcaagatgccgtacctcaggatg
gctgacctgctctccagcttcctgctcattggcgtgctcttcatcatcagcatcagcctg
ctgttcggcgtggtcaagaaccgggagaagtacctgatacccttcctgtcccttcaaatc
atggacttcctgctctgcctgctcacactgctgggctcctacatcgaattgccagcgtac
ttgaagcttgcccggccccggcctggtccttctaaggtccccttgatgacactgcagctg
ctagacttctgtttgagtatcctgaccctgtgcagctcctacatggaagtgcccacctac
ctcaacttcaagtccatgaaccacatgaattacctcccaagccaggagggtgtgccgcac
agccagttcatcaacatgatgctcatcttctcagtggcctttatcaccgtgctcatcctg
aaggtctacatgttcaagtgtgtgtacacatgctacaaattcttgaagcacatgaattcg
gccatggaggacagcagctccaagatgttcctcaaggtggctctgccgtcctacgaggaa
gccttgtctctgccccctaagactccagagggggaccctgcaccacccccatactcagaa
gtgtga

DBGET integrated database retrieval system