KEGG   Mus musculus (mouse): 16801Help
Entry
16801             CDS       T01002                                 

Gene name
Arhgef1, Lbcl2, Lsc
Definition
(RefSeq) Rho guanine nucleotide exchange factor (GEF) 1
  KO
K12330  
Rho guanine nucleotide exchange factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
Vascular smooth muscle contraction
Platelet activation
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    16801 (Arhgef1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    16801 (Arhgef1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    16801 (Arhgef1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    16801 (Arhgef1)
   05205 Proteoglycans in cancer
    16801 (Arhgef1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 A3
AA seq 920 aa AA seqDB search
MGEVAGGAAPGPPRSGLVSIIIGAEDEDFENELEANSEDQNSQFQSLEQVKRRPAHLMAL
LQHVALQFEPGPLLCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPSVAFEL
DRTRPDLISEDVQRRFIQEVVQSQQAAVSRQLEDFRSKRLMGMTPWEQELSLLEPWIGKD
RGNYEARERHVAERLLSHLEETQHTISTDEEKSAAVVTAISLYMRHLGVRTKSGDKKSGR
NFFRKKVMGNRRSDEPPKTKKGLSSILDPARWNRGEPSAPDCRHLKVEADAEKPGPADRK
GGLGMSSRDRTVGTPGQDNPGVSLHPLSTDSVDSREPGVDTPQEPGDTPPQGPTSLEPLA
PPESTEDNGETESPEPGDDGEPGRSGLELEPEEPPGWRELVPPDTLLSLPKSQVKRQEVI
SELLVTEAAHVRMLRVLHDLFYQPMADGGFFPLDELQNIFPSLDELIEVHSLFLDRLMKR
RQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFVQ
EAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEESTERGKVELAAECCREILHH
VNQAVRDMEDLLRLKDYQRRLDLTHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKD
KAIEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATD
HKAFYVIFTWDQEAQIYELVAQTSSERKNWCNLITETAGSLKVPAPASRLKPRPSPSSIR
EPLLSSSENGTGGAEMAPADARTERLLNDLLPFCRPGPEGQLAATALQKVLSLKQILLST
EEDSGAGPPRDGDGVPGGRAPGPVHTQEIEENLLSLEVAIRQLEELEEEFCRLRPLLSQL
GGTLSPNLAAPERSAQTGLS
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagtcgccggaggggcggccccagggcctccccggtctggcctggtgtccatc
atcatcggggcggaggatgaggattttgagaacgagctggaggcgaactcagaagatcaa
aacagccagttccagagcctagagcaagtgaagcgccgccctgcccacctcatggccctc
ctgcagcatgtggccctgcagttcgagccaggaccactgctctgctgcctgcatgcagac
atgctgagctctctgggccccaaagaagccaagaaggccttccttgacttctatcacagt
ttcctggagaagactgcggttctacgggtgccggtccctcccagtgtcgcttttgaactt
gatcgtactcgacctgatctgatctctgaggatgtccagaggcggttcatacaagaggtg
gtgcagagccagcaggcagccgtgagccgtcagctagaggacttccgctccaagcggctc
atgggcatgacgccctgggagcaggaactgagcctgctggagccctggattgggaaagac
cgaggcaactatgaggcccgggagcggcatgttgcggagcggctgctgtcccacctggag
gagacccagcataccatctctacagatgaagagaaaagtgctgctgtggtcactgccatc
agcctgtatatgcgccaccttggagtccggaccaagagtggggacaagaagtcgggaagg
aacttcttccggaaaaaggtgatggggaatcggaggtcagacgaacccccaaagacaaag
aaagggctgagcagtatcctagatcctgcacgttggaaccggggagagccatccgctcca
gattgtcgacatctaaaggtcgaggctgatgcagagaagccaggccctgcagaccggaag
ggaggcctgggtatgtcttctcgggacaggactgttgggactcctggacaggacaaccca
ggagtctccctgcaccctctgtctacagacagcgtcgactcccgggaaccaggcgtggat
accccgcaggagccaggggatacacccccacagggccctaccagcctggagcccctggcg
cccccagagagcacagaggacaatggcgagactgagagccctgagcccggagatgatggg
gagccaggacggtcaggcctggaactggaaccagaagaacctcctgggtggagggaactc
gtgcccccagacaccctgctcagtctgcccaagagccaagtgaagcggcaagaggtcatc
agcgagctgctcgtgactgaggcagctcacgtgcgcatgctacgggtactgcatgacctc
ttctaccagcccatggcggatggaggcttcttccctctggacgagctgcagaacatcttc
ccgagcctggatgagctcatcgaggtgcactccctgttcctcgatcgcttgatgaagcgg
agacaagagagtggctacctcattgaggagatcggcgatgtgctactggcccggttcgat
ggtgctgagggctcatggttccagaagatctcctcccgcttctgcagccgccagtcgttc
gctctagagcagctcaaagccaagcagcgcaaggagcctcggttctgtgcctttgtgcag
gaagctgagagccgcccgagatgccggcgcctacagttaaaggacatgatccccactgag
atgcagcgactgaccaagtacccactgctgctacagagcatcgggcagaacacagaggag
tctacagaacgagggaaagtggagcttgcagctgagtgctgccgggagattctgcaccat
gtcaatcaagccgtccgtgacatggaggacctgctgcggctcaaggattaccagcggcgc
ctggacttgactcacctacggcagagcagtgaccctatgctgagcgagttcaagaacctg
gacatcactaagaagaagttggtccatgaaggccccctcacgtggcgagtgaccaaagac
aaagctatagaagtgcacgtgctcttgctggacgacctgctgctgctgctccagcgccag
gacgagaggctgctgctcaagtcccacagccggacgctgacacctacccccgatggcaag
accatgctgcggccggtgctccggctcacctctgccatgacccgagaggtggccactgat
cacaaagctttctacgtcatttttacctgggaccaggaggcccagatatatgagctggtg
gcacagacatcttcggaacgcaaaaactggtgtaacctcatcactgagactgctggatcc
ctgaaggtccctgcccctgcctcccgcctcaaaccccggcccagcccaagcagcatccga
gaacccctgctcagcagctctgagaatggcactggaggcgcagagatggctccagctgat
gccaggacagagcggctcctcaatgacctcctgcccttctgcagaccaggcccagagggc
cagcttgctgccacagcccttcagaaagtactgtccctgaagcagatcctgctaagcact
gaggaagacagtggagcggggcctccccgcgatggggatggggtgcctggtggtagggcc
cccggcccagtgcacacccaggagattgaggaaaacttgcttagcttagaggtggccatc
agacaactggaggagttggaagaggaattttgtcgcctaagacccctcctgtcccagctt
ggggggactctgtcccccaacctggctgcacctgaacgctctgctcagacaggcctttca
tga

DBGET integrated database retrieval system