KEGG   Mus musculus (mouse): 16801Help
Entry
16801             CDS       T01002                                 

Gene name
Arhgef1, Lbcl2, Lsc
Definition
Rho guanine nucleotide exchange factor (GEF) 1
Orthology
K12330  
Rho guanine nucleotide exchange factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
Vascular smooth muscle contraction
Regulation of actin cytoskeleton
Proteoglycans in cancer
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mmu04810]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:mmu04270]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:mmu05205]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 A3; 7
AA seq 979 aa AA seqDB search
MGEVAGGAAPGPPRSGLVSIIIGAEDEDFENELEANSEDQNSQFQSLEQVKRRPAHLMAL
LQHVALQFEPGPLLCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPSVAFEL
DRTRPDLISEDVQRRFIQEVVQSQQAAVSRQLEDFRSKRLMGMTPWEQELSLLEPWIGKD
RGNYEARERHVAERLLSHLEETQHTISTDEEKSAAVVTAISLYMRHLGVRTKSGDKKSGR
NFFRKKVMGNRRSDEPPKTKKGLSSILDPARWNRGEPSAPDCRHLKVEADEKPGPADRKG
GLGMSSRDRTVGTPGQDNPGVSLHPLSTDSVDSREPGVDTPQEPGDTPPQGPTSLEPLAP
PESTEDNGETERRWKRLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGGRSRSDVDMDPGS
ATAVLGPTRRATPEPGDDGEPGRSGLELEPEEPPGWRELVPPDTLLSLPKSQVKRQEVIS
ELLVTEAAHVRMLRVLHDLFYQPMADGGFFPLDELQNIFPSLDELIEVHSLFLDRLMKRR
QESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFVQE
AESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEESTERGKVELAAECCREILHHV
NQAVRDMEDLLRLKDYQRRLDLTHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDK
AIEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDH
KAFYVIFTWDQEAQIYELVAQTSSERKNWCNLITETAGSLKVPAPASRLKPRPSPSSIRE
PLLSSSENGTGGAEMAPADARTERLLNDLLPFCRPGPEGQLAATALQKVLSLKQILLSTE
EDSGAGPPRDGDGVPGGRAPGPVHTQEIEENLLSLEVAIRQLEELEEEFCRLRPLLSQLG
GTLSPNLAAPERSAQTGLS
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagtcgccggaggggcggccccagggcctccccggtctggcctggtgtccatc
atcatcggggcggaggatgaggattttgagaacgagctggaggcgaactcagaagatcaa
aacagccagttccagagcctagagcaagtgaagcgccgccctgcccacctcatggccctc
ctgcagcatgtggccctgcagttcgagccaggaccactgctctgctgcctgcatgcagac
atgctgagctctctgggccccaaagaagccaagaaggccttccttgacttctatcacagt
ttcctggagaagactgcggttctacgggtgccggtccctcccagtgtcgcttttgaactt
gatcgtactcgacctgatctgatctctgaggatgtccagaggcggttcatacaagaggtg
gtgcagagccagcaggcagccgtgagccgtcagctagaggacttccgctccaagcggctc
atgggcatgacgccctgggagcaggaactgagcctgctggagccctggattgggaaagac
cgaggcaactatgaggcccgggagcggcatgttgcggagcggctgctgtcccacctggag
gagacccagcataccatctctacagatgaagagaaaagtgctgctgtggtcactgccatc
agcctgtatatgcgccaccttggagtccggaccaagagtggggacaagaagtcgggaagg
aacttcttccggaaaaaggtgatggggaatcggaggtcagacgaacccccaaagacaaag
aaagggctgagcagtatcctagatcctgcacgttggaaccggggagagccatccgctcca
gattgtcgacatctaaaggtcgaggctgatgagaagccaggccctgcagaccggaaggga
ggcctgggtatgtcttctcgggacaggactgttgggactcctggacaggacaacccagga
gtctccctgcaccctctgtctacagacagcgtcgactcccgggaaccaggcgtggatacc
ccgcaggagccaggggatacacccccacagggccctaccagcctggagcccctggcgccc
ccagagagcacagaggacaatggcgagactgagagaaggtggaagaggctatcagggcgt
ctagggcgctcagagagcctgcgggtgagtgaccgccgccggccttcccggggcagcctc
ggggctaagggccggggtgggggccgttcccggagcgacgtggacatggacccgggctcc
gccacggccgtgcttggccccacccgacgagccacccctgagcccggagatgatggggag
ccaggacggtcaggcctggaactggaaccagaagaacctcctgggtggagggaactcgtg
cccccagacaccctgctcagtctgcccaagagccaagtgaagcggcaagaggtcatcagc
gagctgctcgtgactgaggcagctcacgtgcgcatgctacgggtactgcatgacctcttc
taccagcccatggcggatggaggcttcttccctctggacgagctgcagaacatcttcccg
agcctggatgagctcatcgaggtgcactccctgttcctcgatcgcttgatgaagcggaga
caagagagtggctacctcattgaggagatcggcgatgtgctactggcccggttcgatggt
gctgagggctcatggttccagaagatctcctcccgcttctgcagccgccagtcgttcgct
ctagagcagctcaaagccaagcagcgcaaggagcctcggttctgtgcctttgtgcaggaa
gctgagagccgcccgagatgccggcgcctacagttaaaggacatgatccccactgagatg
cagcgactgaccaagtacccactgctgctacagagcatcgggcagaacacagaggagtct
acagaacgagggaaagtggagcttgcagctgagtgctgccgggagattctgcaccatgtc
aatcaagccgtccgtgacatggaggacctgctgcggctcaaggattaccagcggcgcctg
gacttgactcacctacggcagagcagtgaccctatgctgagcgagttcaagaacctggac
atcactaagaagaagttggtccatgaaggccccctcacgtggcgagtgaccaaagacaaa
gctatagaagtgcacgtgctcttgctggacgacctgctgctgctgctccagcgccaggac
gagaggctgctgctcaagtcccacagccggacgctgacacctacccccgatggcaagacc
atgctgcggccggtgctccggctcacctctgccatgacccgagaggtggccactgatcac
aaagctttctacgtcatttttacctgggaccaggaggcccagatatatgagctggtggca
cagacatcttcggaacgcaaaaactggtgtaacctcatcactgagactgctggatccctg
aaggtccctgcccctgcctcccgcctcaaaccccggcccagcccaagcagcatccgagaa
cccctgctcagcagctctgagaatggcactggaggcgcagagatggctccagctgatgcc
aggacagagcggctcctcaatgacctcctgcccttctgcagaccaggcccagagggccag
cttgctgccacagcccttcagaaagtactgtccctgaagcagatcctgctaagcactgag
gaagacagtggagcggggcctccccgcgatggggatggggtgcctggtggtagggccccc
ggcccagtgcacacccaggagattgaggaaaacttgcttagcttagaggtggccatcaga
caactggaggagttggaagaggaattttgtcgcctaagacccctcctgtcccagcttggg
gggactctgtcccccaacctggctgcacctgaacgctctgctcagacaggcctttcatga

DBGET integrated database retrieval system